Comparing Dsui_3032 FitnessBrowser__PS:Dsui_3032 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
42% identity, 47% coverage: 232:454/470 of query aligns to 58:276/285 of 3uf6A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
42% identity, 47% coverage: 232:454/470 of query aligns to 60:278/288 of 3u9eB
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
32% identity, 28% coverage: 17:146/470 of query aligns to 35:163/168 of P86397
Sites not aligning to the query:
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 71% coverage: 130:462/470 of query aligns to 369:709/714 of Q8ZND6
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
34% identity, 27% coverage: 18:146/470 of query aligns to 6:134/134 of O32472
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
29% identity, 28% coverage: 18:147/470 of query aligns to 23:152/165 of A0A3Q7HWE4
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
27% identity, 52% coverage: 206:449/470 of query aligns to 43:311/325 of 1xcoD
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
27% identity, 56% coverage: 205:467/470 of query aligns to 39:332/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
27% identity, 56% coverage: 205:467/470 of query aligns to 40:333/333 of P38503
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
29% identity, 46% coverage: 250:467/470 of query aligns to 117:339/339 of 6ioxA
6jqoA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ccoa (see paper)
37% identity, 22% coverage: 12:115/470 of query aligns to 527:632/678 of 6jqoA
Sites not aligning to the query:
6jqnA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ocoa (see paper)
37% identity, 22% coverage: 12:115/470 of query aligns to 527:632/678 of 6jqnA
Sites not aligning to the query:
6jqmA Structure of paaz with NADPH (see paper)
37% identity, 22% coverage: 12:115/470 of query aligns to 527:632/678 of 6jqmA
Sites not aligning to the query:
P77455 Bifunctional protein PaaZ; EC 3.3.2.12; EC 1.2.1.91 from Escherichia coli (strain K12) (see paper)
37% identity, 22% coverage: 12:115/470 of query aligns to 528:633/681 of P77455
Sites not aligning to the query:
>Dsui_3032 FitnessBrowser__PS:Dsui_3032
MHAEHTEQYIENKTFDEIQVGDSSTLIRTLRPEDIKLFAIMSGDVNPSVVDPEFAQSGIF
REVVAHGMWSGALISTVLGTQFPGPGTIYIDQSLHFSRPVTIGDTVTITITAKQKFDHNK
HILFDCQCTNQEGLQVVSGTAEVLAPTEKIRRERVHLPEFTISDKEARYQALLATAAGLE
PIPVAVAHPCDAESLKGPIFAARAGLIEPFLVGPEAKIRSVAEENGLDLTGIRIVNTRHS
HESAAMAVTLVRNGDCEALMKGSLHTDELMGEVVSRANGLRTSRRISHVFYMDVPTYPKP
IMITDAAINIAPTLEDKVDIIQNAIDLFHILGNPEPKVAILSAVETVNPKIQSTLDAAAL
CKMADRGQIKGGLLDGPLAFDNAVSLVAAKTKGIKSAVAGQADILVVPDLESGNMVAKQL
EYLANALSAGVVLGAKCPIVLTSRADTAETRTASCAIAALMAHAYRKQNQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory