SitesBLAST
Comparing Dsui_3057 FitnessBrowser__PS:Dsui_3057 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
62% identity, 99% coverage: 2:446/451 of query aligns to 3:443/445 of P31120
- S100 (= S105) mutation to A: 2% of wild-type activity.; mutation to T: 20-fold increase in the non-specific phosphoglucomutase activity towards glucose-phosphate substrates (non aminated).
- S102 (= S107) active site, Phosphoserine intermediate; modified: Phosphoserine; by autocatalysis; mutation to A: Loss of activity in the absence or presence of glucosamine-1,6-diP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
45% identity, 99% coverage: 4:449/451 of query aligns to 1:440/441 of 3i3wA
- active site: R9 (= R12), S99 (= S107), H100 (= H108), K109 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding zinc ion: S99 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
42% identity, 99% coverage: 4:450/451 of query aligns to 2:445/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
42% identity, 99% coverage: 4:450/451 of query aligns to 2:445/445 of 7ojrA
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
33% identity, 95% coverage: 4:432/451 of query aligns to 3:437/455 of 1wqaA
- active site: R11 (= R12), S101 (= S107), H102 (= H108), K111 (= K117), D243 (= D246), D245 (= D248), D247 (= D250), R248 (= R251), G330 (≠ H333), R340 (≠ G343)
- binding magnesium ion: S101 (= S107), D243 (= D246), D245 (= D248), D247 (= D250)
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 2:448/449 of 6mlwA
- active site: R13 (= R12), S98 (= S107), H99 (= H108), K108 (= K117), D238 (= D246), D240 (= D248), D242 (= D250), R243 (= R251), H325 (= H333)
- binding 2,6-anhydro-5,7-dideoxy-5-fluoro-7-phosphono-D-glycero-D-manno-heptitol: G303 (= G311), H304 (≠ D312), E321 (= E329), S323 (= S331), H325 (= H333), R415 (= R414), S417 (= S416), N418 (≠ G417), T419 (= T418), R424 (= R423)
- binding magnesium ion: S98 (= S107), D238 (= D246), D240 (= D248), D242 (= D250)
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 2:448/449 of 5bmpA
- active site: R13 (= R12), S98 (= S107), H99 (= H108), K108 (= K117), D238 (= D246), D240 (= D248), D242 (= D250), R243 (= R251), H325 (= H333)
- binding 1-O-phosphono-alpha-D-glucopyranose: R281 (≠ L288), G303 (= G311), E321 (= E329), S323 (= S331), H325 (= H333), R415 (= R414), S417 (= S416), N418 (≠ G417), T419 (= T418), R424 (= R423)
- binding magnesium ion: S98 (= S107), D238 (= D246), D240 (= D248), D242 (= D250)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6nqhA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding magnesium ion: D237 (= D246), D239 (= D248), D241 (= D250)
- binding 1-O-phosphono-alpha-D-xylopyranose: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D239 (= D248), R242 (= R251), R280 (≠ L288), S301 (≠ V310), G302 (= G311), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), T418 (= T418), R423 (= R423)
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6np8A
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding calcium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (≠ D9), R280 (≠ L288), G302 (= G311), H303 (≠ D312), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), T418 (= T418), R423 (= R423)
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6nolA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G311), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), T418 (= T418), R423 (= R423)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6nnpA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ L288), G302 (= G311), H303 (≠ D312), E320 (= E329), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), T418 (= T418), R423 (= R423)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6nn2A
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding calcium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6n1eA
6mnvA Crystal structure of x. Citri phosphoglucomutase in complex with ch2fg1p (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6mnvA
- binding 1-deoxy-1-fluoro-2-O-phosphono-alpha-D-gluco-hept-2-ulopyranose: R280 (≠ L288), G302 (= G311), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), T418 (= T418), R423 (= R423)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
6mlhA Crystal structure of x. Citri phosphoglucomutase in complex with glucopyranosyl-1-methyl-phosphonic acid (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6mlhA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding (1S)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: R280 (≠ L288), G302 (= G311), E320 (= E329), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), T418 (= T418), R423 (= R423)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
6mlfA Crystal structure of x. Citri phosphoglucomutase in complex with 6- fluoro glucose 1-phosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 6mlfA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding 6-deoxy-6-fluoro-1-O-phosphono-alpha-D-glucopyranose: R280 (≠ L288), G302 (= G311), E320 (= E329), H324 (= H333), R414 (= R414), S416 (= S416), T418 (= T418), R423 (= R423)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
5kl0A Crystal structure of phosphoglucomutase from xanthomonas citri citri complexed with glucose-1,6-biphosphate (see paper)
29% identity, 99% coverage: 1:446/451 of query aligns to 1:447/448 of 5kl0A
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H333)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: S97 (= S107), G302 (= G311), H303 (≠ D312), E320 (= E329), H324 (= H333), R414 (= R414), S416 (= S416), N417 (≠ G417), R423 (= R423)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
28% identity, 95% coverage: 11:437/451 of query aligns to 11:436/455 of 2h5aX
- active site: H101 (= H108), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), D332 (≠ G343)
- binding 1-O-phosphono-alpha-D-xylopyranose: T298 (≠ V310), G299 (= G311), H300 (≠ D312), E317 (= E329), S319 (= S331), H321 (= H333), R413 (= R414), S415 (= S416), N416 (≠ G417), T417 (= T418)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
28% identity, 95% coverage: 11:437/451 of query aligns to 11:436/455 of 2h4lX
- active site: H101 (= H108), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), D332 (≠ G343)
- binding 1-O-phosphono-alpha-D-ribofuranose: R12 (= R12), S100 (= S107), T298 (≠ V310), E317 (= E329), R413 (= R414), S415 (= S416), N416 (≠ G417), T417 (= T418)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
28% identity, 95% coverage: 11:437/451 of query aligns to 11:436/455 of 2fkfA
- active site: R12 (= R12), S100 (= S107), H101 (= H108), K110 (= K117), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), H321 (= H333), D332 (≠ G343)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: H101 (= H108), S319 (= S331), R413 (= R414), S415 (= S416), N416 (≠ G417), T417 (= T418)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
Query Sequence
>Dsui_3057 FitnessBrowser__PS:Dsui_3057
MSRKYFGTDGVRGRVGEAPITPDFAMRLGYSAGQVLVAQDGLPAGERPAVLIGKDTRISG
YMLEAALEAGFSAAGVDVCLVGPMPTPAVAYLTRALRLQAGIVISASHNPFYDNGIKFFS
AQGTKLPDAVEHAIEAGVEAPMGCVPSDRLGKARRIDDARGRYIEFCKSTFPNDLDLRGL
KIVVDCAHGAAYHIAPDVFHELGADVVAIGNRPDGLNINAAVGATAPKALKEAVLGQRAD
LGIALDGDGDRLVMVDGEGNVYDGDQLLYAIVRGRQALGPVAGVAGTLMTNLALEDALKA
LDIPFARAAVGDRYVLEKLVQNGWLYGGENSGHILCLDRHTTGDGIIAALQVLAALRQQG
GSLKALLGDLVLYPQKLINVPMPKGFPWQDSPAIAAAQRAVEAELDGRGRVLLRASGTEP
LLRVMVEGRDGELIARLAEKLAGAVRQAVGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory