SitesBLAST
Comparing Dsui_3149 FitnessBrowser__PS:Dsui_3149 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
47% identity, 92% coverage: 16:347/360 of query aligns to 57:384/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L142), R200 (= R162), M281 (≠ K244), G282 (= G245), R307 (= R270), A308 (= A271), Q320 (= Q283), V321 (= V284), G322 (= G285), Q323 (= Q286), T324 (= T287), G337 (= G300), I338 (= I301), S339 (= S302), Q343 (= Q306), H344 (= H307), N358 (= N321), K359 (≠ N322), L377 (≠ C340)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
51% identity, 93% coverage: 25:359/360 of query aligns to 5:335/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (= T143), R140 (= R162), T142 (= T164), G219 (= G243), K220 (= K244), G221 (= G245), S245 (= S269), R246 (= R270), A247 (= A271), Q259 (= Q283), V260 (= V284), G261 (= G285), Q262 (= Q286), T263 (= T287), G276 (= G300), S278 (= S302), Q282 (= Q306), H283 (= H307), N297 (= N321), I298 (≠ N322), L316 (≠ C340)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
43% identity, 89% coverage: 27:347/360 of query aligns to 4:320/331 of 5ol2A
- binding calcium ion: E75 (≠ V101), D188 (= D214)
- binding flavin-adenine dinucleotide: T117 (= T143), R136 (= R162), I147 (= I173), G216 (= G243), R217 (≠ K244), G218 (= G245), S242 (= S269), R243 (= R270), A244 (= A271), Q256 (= Q283), V257 (= V284), G258 (= G285), T260 (= T287), G273 (= G300), I274 (= I301), S275 (= S302), A277 (= A304), Q279 (= Q306), H280 (= H307), N294 (= N321), K295 (≠ N322), D312 (= D339), V313 (≠ C340)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
39% identity, 90% coverage: 25:347/360 of query aligns to 11:328/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L142), R144 (= R162), I155 (= I173), G224 (= G243), R225 (≠ K244), G226 (= G245), S250 (= S269), R251 (= R270), A252 (= A271), Q264 (= Q283), V265 (= V284), G266 (= G285), Q267 (= Q286), S268 (≠ T287), G281 (= G300), I282 (= I301), S283 (= S302), S285 (≠ A304), Q287 (= Q306), H288 (= H307), N302 (= N321), K303 (≠ N322), D320 (= D339), A321 (≠ C340)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
37% identity, 95% coverage: 13:353/360 of query aligns to 1:333/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L142), T126 (= T143), R144 (= R162), I155 (= I173), R224 (≠ K244), G225 (= G245), T249 (≠ S269), R250 (= R270), Q263 (= Q283), I264 (≠ V284), G265 (= G285), L266 (≠ Q286), S267 (≠ T287), G280 (= G300), I281 (= I301), S282 (= S302), Q286 (= Q306), N301 (= N321), S302 (≠ N322), D303 (= D323), D319 (= D339), L320 (≠ C340)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
34% identity, 91% coverage: 20:347/360 of query aligns to 15:326/333 of P13804
- 20:204 (vs. 25:228, 20% identical) Domain I
- G116 (= G127) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ R188) to I: decreased protein stability; dbSNP:rs1801591
- R223 (≠ K244) binding
- S248 (= S269) binding
- R249 (= R270) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 284:287) binding
- T266 (= T287) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 302:307) binding
- N300 (= N321) binding
- DL 318:319 (≠ DC 339:340) binding
Sites not aligning to the query:
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
33% identity, 90% coverage: 24:347/360 of query aligns to 1:308/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G243), R205 (≠ K244), S230 (= S269), R231 (= R270), A232 (= A271), Q244 (= Q283), V245 (= V284), G246 (= G285), T248 (= T287), G261 (= G300), I262 (= I301), S263 (= S302), A265 (= A304), Q267 (= Q306), H268 (= H307), N282 (= N321), K283 (≠ N322), D300 (= D339), L301 (≠ C340)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
34% identity, 74% coverage: 81:347/360 of query aligns to 41:287/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G243), R184 (≠ K244), G185 (= G245), S209 (= S269), R210 (= R270), Q223 (= Q283), I224 (≠ V284), G225 (= G285), T227 (= T287), G240 (= G300), V241 (≠ I301), S242 (= S302), A244 (= A304), Q246 (= Q306), H247 (= H307), N261 (= N321), K262 (≠ N322), D279 (= D339), Y280 (≠ C340)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
55% identity, 34% coverage: 227:347/360 of query aligns to 183:303/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G243), R200 (≠ K244), G201 (= G245), S225 (= S269), R226 (= R270), A227 (= A271), Q239 (= Q283), V240 (= V284), G241 (= G285), T243 (= T287), G256 (= G300), I257 (= I301), S258 (= S302), A260 (= A304), Q262 (= Q306), H263 (= H307), N277 (= N321), K278 (≠ N322), D295 (= D339), L296 (≠ C340)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
29% identity, 87% coverage: 27:339/360 of query aligns to 4:307/321 of P53571
- R211 (≠ K244) binding
- SR 236:237 (= SR 269:270) binding
- QVGQS 250:254 (≠ QVGQT 283:287) binding
- 268:275 (vs. 300:307, 88% identical) binding
- N289 (= N321) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 307:308 binding
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
28% identity, 87% coverage: 27:339/360 of query aligns to 3:306/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G243), R210 (≠ K244), G211 (= G245), S235 (= S269), A236 (≠ R270), P237 (≠ A271), Q249 (= Q283), V250 (= V284), G251 (= G285), Q252 (= Q286), S253 (≠ T287), G267 (= G300), I268 (= I301), S269 (= S302), S271 (≠ A304), Q273 (= Q306), H274 (= H307), N288 (= N321), T289 (≠ N322), D306 (= D339)
Sites not aligning to the query:
Query Sequence
>Dsui_3149 FitnessBrowser__PS:Dsui_3149
MSEAKTDKPIKKRKIKLDEELLAYKGVWVFVESERGHVHPVSWELMGQGRRLADQLGVEL
CGVVMGAPGPDLEAQCRAAFAYGADRCYRIASPVLAEYRNVPFTRALTDLVNAHKPEILL
LGATTLGRDLAGSVATTLKTGLTADCTELAIDPEDRCLLSTRPTFGGSLLCTIVTLNYRP
QMATVRHRVMPMPDPQPERTGLIVDFEAGLIETDIVTKVLEFIPDDQRDKPQLPYAEIVV
SGGKGLGKAENFKHVWDLAKVLGGEVGASRAAIHAGWISADRQVGQTGKTVRPALYIAAG
ISGAIQHRVGMEGADCIIAINNDPNAPIFDFAHYAIVGDCNQVLPALGRTFAGYLAHQGS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory