Comparing Dsui_3199 FitnessBrowser__PS:Dsui_3199 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
52% identity, 98% coverage: 4:210/212 of query aligns to 540:734/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 94% coverage: 1:200/212 of query aligns to 1:184/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 68% coverage: 17:160/212 of query aligns to 12:126/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
32% identity, 68% coverage: 17:160/212 of query aligns to 12:126/167 of 2pkpA
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
33% identity, 43% coverage: 79:170/212 of query aligns to 781:878/909 of P09339
Sites not aligning to the query:
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
33% identity, 37% coverage: 79:156/212 of query aligns to 658:744/780 of P20004
Sites not aligning to the query:
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
38% identity, 35% coverage: 73:147/212 of query aligns to 648:732/778 of P19414
Sites not aligning to the query:
>Dsui_3199 FitnessBrowser__PS:Dsui_3199
MQAFTKLDGLVAPLDRNNVDTDAIIPKQFLKSIKRSGFGPNAFDEWRYMDHGEPGMDNSK
RPLNPNFVLNQQRYQGASVLLTRSNFGCGSSREHAPWALLDYGFRVVIAESFADIFFNNC
FKNGILPIVLPKTEIDALFGLTEYTPGFKLVVDLEQQKVVRPDGHAIPFEVDAFRRECLL
NGWDDIGLTLRHADKIKAFEERRRAEQPWLFS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory