Comparing Dsui_3227 FitnessBrowser__PS:Dsui_3227 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
51% identity, 98% coverage: 3:552/560 of query aligns to 40:644/644 of P9WQB3
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
53% identity, 98% coverage: 3:552/560 of query aligns to 23:577/577 of 3figB
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
53% identity, 98% coverage: 3:551/560 of query aligns to 23:576/576 of 3hpzB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
53% identity, 98% coverage: 3:551/560 of query aligns to 23:573/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
53% identity, 98% coverage: 3:551/560 of query aligns to 23:573/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
53% identity, 98% coverage: 3:551/560 of query aligns to 23:575/575 of 3hpsA
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
27% identity, 70% coverage: 38:429/560 of query aligns to 11:377/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
27% identity, 70% coverage: 38:429/560 of query aligns to 11:379/380 of 4ov9A
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 93% coverage: 28:549/560 of query aligns to 4:501/517 of Q9JZG1
Sites not aligning to the query:
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
28% identity, 65% coverage: 21:383/560 of query aligns to 3:362/409 of 6e1jA
Sites not aligning to the query:
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 63% coverage: 34:383/560 of query aligns to 88:429/503 of Q9FN52
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
30% identity, 53% coverage: 36:332/560 of query aligns to 9:293/308 of 3rmjB
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 65% coverage: 21:383/560 of query aligns to 70:429/506 of Q9FG67
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
22% identity, 63% coverage: 34:386/560 of query aligns to 25:346/399 of 6ktqA
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
25% identity, 55% coverage: 34:342/560 of query aligns to 33:320/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
25% identity, 55% coverage: 34:342/560 of query aligns to 38:325/418 of Q9Y823
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
25% identity, 55% coverage: 34:342/560 of query aligns to 15:291/370 of 3mi3A
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
27% identity, 55% coverage: 33:342/560 of query aligns to 4:290/314 of 2zyfA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
28% identity, 55% coverage: 33:342/560 of query aligns to 3:289/347 of 3a9iA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
28% identity, 55% coverage: 33:342/560 of query aligns to 4:296/376 of O87198
>Dsui_3227 FitnessBrowser__PS:Dsui_3227
MLSNPSSKYRPFAPVQLADRQWPSRVITTPPMWMSTDLRDGNQSLFEPMNVEKKMRMFKT
LCQVGFKEIEVAFPSASQTDFNFVRSLIEDGHIPQDVTIEVLTQAREHLIRRTMESIKGA
PRAIVHVYNATSQPFRDFVFGMSKAEVVAMAVEAVTLIKQLAAEMPETEVVLEYSPETFT
ATELDFALEVCDAVTAAWGATPDNKVILNLPTTVEMATPNIYADQIEWMHRHLARRDSVI
LSLHPHNDRGTAVAAAELGLMAGADRVEGCLFGNGERTGNVDIVTVALNMYTQGVHPGLD
FSDINAVARTVEHCNQLPIHPRHPYVGDLVFTAFSGSHQDAIKKGFSAQKADAPWNVPYL
PIDPADVGRSYDSVIRVNSQSGKGGIAYLLETEYGVVMPRRLQVEFSGVVQQHADSHGSE
LTAADIWQLFCRTYLEPVAPVHYREHHLFEHGSAQGIRLSVDIDGTAHLLSGEGNGPIDA
AIHALRGAGMQVQVRSYEERSMAPSQDGGEARACAFVEMACDGREFYGVGIDGNIVTASL
KAIVSGLNRSGQQFRTHQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory