Comparing Dsui_3244 FitnessBrowser__PS:Dsui_3244 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
7d54A Crstal structure msgatase with gln (see paper)
33% identity, 53% coverage: 65:188/236 of query aligns to 79:193/242 of 7d54A
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
38% identity, 42% coverage: 50:147/236 of query aligns to 46:134/475 of 2ywcA
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 49% coverage: 27:142/236 of query aligns to 50:156/693 of P49915
Sites not aligning to the query:
>Dsui_3244 FitnessBrowser__PS:Dsui_3244
MRPVAIFRHTPTEGPGYFATFLEGHGIAWELIPVDAGAPVPASPEAYAGLCFMGGPMSVN
DPLPWIDHTCALIRSAVAAGIPVLGHCLGGQLMAKALGGRVTPNPIKEIGWGTARIEEGE
IPGHWFNGLGGEVTVFQWHGETFSLPPQAVRLLTNDFCANQMFALGPHLAMQCHVEMTPE
LIATWSSDWADEARAAARHPAGQTPEQMVAEIEWRLPAMRQLADRLYGAWIANLRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory