SitesBLAST
Comparing Dsui_3259 FitnessBrowser__PS:Dsui_3259 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
62% identity, 100% coverage: 1:256/256 of query aligns to 3:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), S13 (= S11), R14 (= R12), G15 (= G13), I16 (= I14), L36 (≠ R34), R37 (≠ Q35), N38 (≠ D36), A61 (= A67), D62 (= D68), V63 (≠ I69), N89 (= N95), A90 (= A96), G91 (= G97), T113 (= T119), V143 (≠ L149), S145 (= S151), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), I196 (= I202), H197 (= H203)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
59% identity, 100% coverage: 1:256/256 of query aligns to 1:248/248 of 4iqgD
- active site: G13 (= G13), N112 (= N120), S143 (= S151), Y154 (= Y162), Y157 (= Y165), K161 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G9), S11 (= S11), R12 (= R12), G13 (= G13), I14 (= I14), N32 (≠ S32), A34 (≠ R34), S35 (≠ Q35), N36 (≠ D36), A59 (= A67), D60 (= D68), V61 (≠ I69), N87 (= N95), A88 (= A96), G89 (= G97), V141 (≠ L149), S143 (= S151), Y157 (= Y165), K161 (= K169), P187 (= P195), G188 (= G196), I190 (= I198), T192 (= T200), I194 (= I202), H195 (= H203)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 99% coverage: 3:255/256 of query aligns to 6:244/247 of 4jroC
- active site: G16 (= G13), S142 (= S151), Q152 (≠ E161), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (= I14), N35 (≠ S32), Y36 (= Y33), N37 (≠ R34), G38 (≠ Q35), S39 (≠ D36), N63 (≠ D68), V64 (≠ I69), N90 (= N95), A91 (= A96), I93 (= I98), I113 (≠ T119), S142 (= S151), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (= I198), T190 (= T200)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 100% coverage: 1:255/256 of query aligns to 3:243/246 of 3osuA
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
37% identity, 100% coverage: 1:255/256 of query aligns to 5:236/241 of 4cqmF
- active site: G17 (= G13), S139 (= S151), Q149 (≠ E161), Y152 (= Y165), K156 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), R16 (= R12), G17 (= G13), I18 (= I14), A37 (≠ F31), R38 (≠ S32), N39 (≠ Y33), D60 (= D68), V61 (≠ I69), A87 (≠ N95), A88 (= A96), G89 (= G97), V137 (≠ L149), S139 (= S151), Y152 (= Y165), K156 (= K169), V185 (≠ I198), T187 (= T200), M189 (≠ I202)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
37% identity, 100% coverage: 1:255/256 of query aligns to 1:232/237 of Q8N4T8
- G9 (= G9) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (= SRGI 11:14) binding
- R12 (= R12) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (≠ S32) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (≠ SY 32:33) binding
- D56 (= D68) binding
- L70 (≠ A82) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ NAG 95:97) binding
- S135 (= S151) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y165) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K169) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (≠ A185) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (≠ E186) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ IDT 198:200) binding
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
37% identity, 98% coverage: 6:255/256 of query aligns to 10:243/247 of P73574
- A14 (≠ G10) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ A159) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K169) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L197) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R211) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 98% coverage: 6:255/256 of query aligns to 10:248/252 of 1vl8B
- active site: G17 (= G13), S143 (= S151), I154 (≠ Y162), Y157 (= Y165), K161 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), R16 (= R12), G17 (= G13), L18 (≠ I14), S37 (≠ Y33), R38 (= R34), C63 (≠ A67), D64 (= D68), V65 (≠ I69), A91 (≠ N95), A92 (= A96), G93 (= G97), I94 (= I98), V114 (≠ T119), I141 (≠ L149), S143 (= S151), Y157 (= Y165), K161 (= K169), P187 (= P195), G188 (= G196), Y190 (≠ I198), T192 (= T200), M194 (≠ I202), T195 (vs. gap)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
34% identity, 99% coverage: 3:255/256 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G13), S138 (= S151), Q148 (≠ E161), Y151 (= Y165), K155 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), S10 (= S11), R11 (= R12), I13 (= I14), N31 (≠ S32), Y32 (= Y33), A33 (≠ R34), G34 (≠ Q35), S35 (≠ D36), A58 (= A67), N59 (≠ D68), V60 (≠ I69), N86 (= N95), A87 (= A96), T109 (= T119), S138 (= S151), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 99% coverage: 3:255/256 of query aligns to 9:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G9), R18 (= R12), G19 (= G13), I20 (= I14), D39 (≠ Y33), R40 (= R34), C63 (≠ A67), I65 (= I69), N91 (= N95), G93 (= G97), I94 (= I98), V114 (≠ T119), Y155 (= Y165), K159 (= K169), I188 (= I198), T190 (= T200), T193 (≠ S205)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
31% identity, 99% coverage: 3:255/256 of query aligns to 47:285/290 of 3ijrF
- active site: G57 (= G13), S182 (= S151), L192 (≠ Y162), Y195 (= Y165), K199 (= K169), K240 (≠ G210)
- binding magnesium ion: D55 (≠ S11), S56 (≠ R12), E80 (≠ D36)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ S11), S56 (≠ R12), G57 (= G13), I58 (= I14), Y77 (= Y33), L78 (≠ R34), E80 (≠ D36), G103 (≠ A67), D104 (= D68), L105 (≠ I69), N131 (= N95), V132 (≠ A96), A133 (≠ G97), Q134 (≠ I98), I155 (≠ T119), T180 (≠ L149), S182 (= S151), Y195 (= Y165), K199 (= K169), P225 (= P195), G226 (= G196), P227 (≠ L197), I228 (= I198), T230 (= T200), L232 (≠ I202)
Sites not aligning to the query:
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
31% identity, 99% coverage: 3:255/256 of query aligns to 39:277/282 of 3i3oA
- active site: G49 (= G13), S174 (= S151), L184 (≠ Y162), Y187 (= Y165), K191 (= K169), K232 (≠ G210)
- binding magnesium ion: D47 (≠ S11), S48 (≠ R12), E72 (≠ D36)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G9), D47 (≠ S11), S48 (≠ R12), G49 (= G13), I50 (= I14), Y69 (= Y33), L70 (≠ R34), E72 (≠ D36), G95 (≠ A67), D96 (= D68), L97 (≠ I69), N123 (= N95), V124 (≠ A96), A125 (≠ G97), Q126 (≠ I98), Q127 (≠ L99), I147 (≠ T119), T172 (≠ L149), S174 (= S151), Y187 (= Y165), K191 (= K169), P217 (= P195), G218 (= G196), I220 (= I198), T222 (= T200), L224 (≠ I202)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 99% coverage: 3:255/256 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G13), N111 (= N120), S139 (= S151), Q149 (≠ E161), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (≠ Q102), K98 (≠ D107), S139 (= S151), N146 (≠ A158), V147 (≠ A159), Q149 (≠ E161), Y152 (= Y165), F184 (≠ L197), M189 (≠ I202), K200 (≠ R214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G9), N17 (≠ R12), G18 (= G13), I19 (= I14), D38 (≠ Y33), F39 (≠ R34), V59 (≠ A67), D60 (= D68), V61 (≠ I69), N87 (= N95), A88 (= A96), G89 (= G97), I90 (= I98), T137 (≠ L149), S139 (= S151), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (≠ L197), T185 (≠ I198), T187 (= T200), M189 (≠ I202)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
35% identity, 99% coverage: 3:256/256 of query aligns to 10:248/251 of 6d9yB
- active site: G20 (= G13), S145 (= S151), Y158 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G16 (= G9), R19 (= R12), G20 (= G13), D40 (≠ Q42), L41 (= L43), V64 (≠ A67), D65 (= D68), Q66 (≠ I69), A93 (= A96), S145 (= S151), Y158 (= Y165), K162 (= K169), P188 (= P195), A189 (≠ G196), A190 (≠ L197), A191 (≠ I198), T193 (= T200)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
36% identity, 99% coverage: 3:255/256 of query aligns to 6:242/245 of 5wuwA
- active site: G16 (= G13), S140 (= S150), Y154 (= Y165), L161 (≠ I172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), R15 (= R12), I17 (= I14), Y36 (= Y33), A37 (≠ R34), A38 (≠ Q35), D63 (= D68), S64 (≠ I69), N90 (= N95), A91 (= A96), G92 (= G97), Y154 (= Y165), K158 (= K169), G185 (= G196), P186 (≠ L197), V187 (≠ I198)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
34% identity, 98% coverage: 5:255/256 of query aligns to 4:241/244 of 1edoA
- active site: G12 (= G13), S138 (= S151), Y151 (= Y165), K155 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), S10 (= S11), R11 (= R12), I13 (= I14), N31 (≠ S32), Y32 (= Y33), A33 (≠ R34), R34 (≠ Q35), S35 (≠ D36), D59 (= D68), V60 (≠ I69), N86 (= N95), A87 (= A96), S138 (= S151), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196), I184 (= I198), S186 (≠ T200), M188 (≠ I202)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
33% identity, 99% coverage: 3:255/256 of query aligns to 12:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G9), S20 (= S11), K21 (≠ R12), G22 (= G13), I23 (= I14), A43 (≠ R34), S44 (≠ Q35), S45 (≠ D36), G68 (≠ A67), D69 (= D68), V70 (≠ I69), N96 (= N95), S97 (≠ A96), G98 (= G97), Y100 (≠ L99), I144 (≠ L149), S146 (= S151), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), M191 (≠ L197), I192 (= I198), T194 (= T200), G196 (vs. gap), T197 (≠ I202)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S151), Y159 (= Y165), M191 (≠ L197), I202 (≠ G207)
8jfgA Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori (see paper)
33% identity, 99% coverage: 3:255/256 of query aligns to 7:245/248 of 8jfgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), K16 (≠ R12), I18 (= I14), R38 (= R34), A65 (≠ I69), N91 (= N95), A92 (= A96), G93 (= G97), A142 (≠ S150), S143 (= S151), Y156 (= Y165), K160 (= K169), P186 (= P195), I189 (= I198), T191 (= T200), M193 (≠ I202), N194 (≠ H203)
- binding ~{S}-[2-[3-[[(2~{S})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate: D97 (≠ L101), S143 (= S151), I145 (≠ A153), M151 (≠ A159), G152 (= G160), Q153 (≠ E161), Y156 (= Y165), G187 (= G196), F188 (≠ L197), Y205 (≠ R214)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
37% identity, 98% coverage: 6:255/256 of query aligns to 9:236/240 of 4dmmB
- active site: G16 (= G13), S142 (= S151), Q152 (≠ E161), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (= I14), A37 (≠ R34), S38 (≠ Q35), S39 (≠ D36), A62 (= A67), D63 (= D68), V64 (≠ I69), N90 (= N95), A91 (= A96), L113 (≠ T119), I140 (≠ L149), S142 (= S151), Y155 (= Y165), K159 (= K169), P185 (= P195), G186 (= G196), I188 (= I198), T190 (= T200), M192 (≠ I202)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
37% identity, 98% coverage: 6:255/256 of query aligns to 12:248/251 of 4cqlI
- active site: G19 (= G13), S146 (= S151), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ R12), G19 (= G13), I20 (= I14), D39 (≠ R34), L40 (≠ Q35), A64 (= A67), D65 (= D68), V66 (≠ I69), C93 (≠ N95), A94 (= A96), G95 (= G97), I96 (= I98), V116 (≠ T119), I144 (≠ L149), S146 (= S151), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), M196 (≠ I202)
Query Sequence
>Dsui_3259 FitnessBrowser__PS:Dsui_3259
MHKTLLITGGSRGIGAATVRLAARAGYAVCFSYRQDAAAAQQLVAEVTRESSRDSGREGA
PILAFQADISREEEIRALFAAAEQRFGPITALVNNAGILELQTRVEDMDGDRLQRIFATN
VIGTFLCCREAVRRLSTRHGGHGGAIVNLSSRAARLGAAGEYVDYAASKAAIDTLTLGLA
REVAAEGIRVNAVAPGLIDTDIHASGGEPGRVERLRTGIPMQRGGTPEEVAKAILWLLSE
DASYTTGAILDVAGGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory