Comparing Dsui_3391 FitnessBrowser__PS:Dsui_3391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3fijA Crystal structure of a uncharacterized protein lin1909
39% identity, 72% coverage: 70:256/259 of query aligns to 39:222/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 71% coverage: 72:255/259 of query aligns to 123:296/308 of O33341
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
41% identity, 63% coverage: 73:234/259 of query aligns to 60:225/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
40% identity, 65% coverage: 66:234/259 of query aligns to 55:227/254 of P76038
7d53A Spua mutant - h221n with glu (see paper)
37% identity, 74% coverage: 67:257/259 of query aligns to 52:245/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
37% identity, 74% coverage: 67:257/259 of query aligns to 58:251/255 of 7d50B
7d4rB Spua native structure (see paper)
40% identity, 58% coverage: 107:257/259 of query aligns to 61:213/215 of 7d4rB
>Dsui_3391 FitnessBrowser__PS:Dsui_3391
MAKRTVKIGISARLYHPQPESVGLLGKTLQYLEQSVAHWVMSRDVLVFMVPSIVQDSPMQ
RSNMRLADYVGALDGLVLQGGTDLSPLSYGEEPLKPEWAGDRVRDAYEMELLHEFMEAGK
PVLGICRGLQLINVALGGSLHQDIPSLVEDAIAHEAPEYDRHTHPVQFAEGGLLARLYPE
QTGGQVVSIHHQAVKVLGKDLTVEATAADGLVEAVRWTGRGFVVGLQWHPEFHTPGKGEL
LDGEPLLQAFLEEAKKRRW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory