SitesBLAST
Comparing Dsui_3414 FitnessBrowser__PS:Dsui_3414 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 43% coverage: 15:171/366 of query aligns to 64:220/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ L24), G75 (= G26), S76 (≠ G27), G77 (= G28), T78 (≠ S29), G79 (≠ D31), L80 (≠ F32), A83 (≠ R35), C84 (≠ P36), P137 (≠ F89), G138 (= G90), E139 (vs. gap), A142 (= A93), T143 (= T94), G146 (= G97), N147 (≠ M98), S149 (≠ A100), T150 (≠ A101), A152 (≠ L103), G153 (≠ S104), E203 (≠ L154), G204 (= G155), I209 (≠ L160)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 43% coverage: 15:170/366 of query aligns to 59:214/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdrA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 324, 370, 414, 451
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: 319, 323, 415
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdqA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding (2R)-2-hydroxy-4-methylpentanoic acid: 319, 323, 370, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 370, 414, 451
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdoA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding (2R)-2-hydroxyhexanoic acid: 319, 323, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 324, 370, 414, 451
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdnA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 370, 414, 451
- binding (2R)-2-oxidanylpentanoic acid: 319, 323, 415
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdgA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 370, 414, 451
- binding (2R)-2-oxidanylbutanoic acid: 319, 415
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdbA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 324, 370, 414, 451
- binding (2R)-2-oxidanyloctanoic acid: 75, 319, 323, 415
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/454 of 8jdzA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding (3S)-3-methyl-2-oxopentanoic acid: 318, 322, 369, 376, 413
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 322, 412, 413, 449
- binding manganese (ii) ion: 369, 376, 412
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/454 of 8jdyA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding 2-oxo-4-methylpentanoic acid: 318, 322, 336, 369, 376, 413
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 412, 449
- binding manganese (ii) ion: 369, 376, 412
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/455 of 8jdxA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 414, 450
- binding 3-methyl-2-oxobutanoic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/456 of 8jdsA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 323, 414, 415, 451
- binding manganese (ii) ion: 370, 377, 414
- binding pyruvic acid: 319, 370, 377, 415
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/455 of 8jdeA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 414, 450
- binding lactic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/455 of 8jduA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding 2-oxopentanoic acid: 318, 322, 369, 376, 414
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 450
- binding manganese (ii) ion: 369, 376, 413
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/455 of 8jdtA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding 2-ketobutyric acid: 318, 369, 376, 414
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 322, 413, 414, 450
- binding manganese (ii) ion: 369, 376, 413
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/455 of 8jdpA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 369, 413, 450
- binding deaminohydroxyvaline: 319, 414
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 39% coverage: 37:177/366 of query aligns to 82:221/454 of 8jdvA
- binding flavin-adenine dinucleotide: L90 (≠ R45), P132 (= P86), G133 (= G90), A134 (≠ P91), G140 (= G97), M141 (= M98), A143 (= A100), T144 (≠ A101), A146 (≠ L103), S147 (= S104), E200 (≠ L154), G201 (= G155), I206 (≠ L160)
Sites not aligning to the query:
- binding 2-Ketohexanoic acid: 75, 317, 321, 368, 375, 413
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 321, 322, 412, 413, 449
- binding manganese (ii) ion: 368, 375, 412
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
28% identity, 43% coverage: 14:171/366 of query aligns to 224:385/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
27% identity, 43% coverage: 14:171/366 of query aligns to 144:305/557 of 5adzC
- binding flavin-adenine dinucleotide: P154 (≠ L24), I155 (≠ R25), G156 (= G26), G157 (= G27), G158 (= G28), T159 (≠ S29), S160 (≠ K30), P222 (= P86), D223 (≠ P87), S224 (≠ H88), S228 (≠ A93), T229 (= T94), G232 (= G97), W233 (≠ M98), S235 (≠ A100), T236 (≠ A101), A238 (≠ L103), S239 (= S104), E288 (≠ L154), G289 (= G155), I294 (≠ L160)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P87)
Sites not aligning to the query:
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
27% identity, 43% coverage: 14:171/366 of query aligns to 135:296/555 of 4bc9A
- binding propanenitrile: D214 (≠ P87)
- binding flavin-adenine dinucleotide: P145 (≠ L24), I146 (≠ R25), G147 (= G26), G148 (= G27), G149 (= G28), T150 (≠ S29), S151 (≠ K30), V152 (≠ D31), G155 (= G34), L156 (≠ R35), P213 (= P86), D214 (≠ P87), S215 (≠ H88), S219 (≠ A93), T220 (= T94), G223 (= G97), W224 (≠ M98), S226 (≠ A100), T227 (≠ A101), A229 (≠ L103), S230 (= S104), E279 (≠ L154), V284 (≠ L159), I285 (≠ L160)
Sites not aligning to the query:
Query Sequence
>Dsui_3414 FitnessBrowser__PS:Dsui_3414
MSQVFEQQCRERILAASAGAPLLLRGGGSKDFYGRPVQGDILDTRSHRGVVAYEPTELVV
TVKAGTSLAELEAVLAEKGQYLACEPPHFGPDATVGGMVAAGLSGPRRAQAGAVRDFVLG
VRLMDGQGQALNFGGQVMKNVAGYDVPRLLAGSLGQLGLLLEVSLKVLPRPVAEATIRLE
TSQAKALALMNQWGGKPLPISATVWSDAGHPDGEAITVRLSGARAAVAAAQAALGGALVE
AGPASAFWAGVREQTHPFFTGAGGANESALWRLAVPSTAPQLDLPGRTLVEWGGAQRWLV
SDAEPRRIREAVEKAGGHATLFRGPAAARDQAFHPLASPLLDIHRRLKATFDPRGVFAAG
RLYEGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory