SitesBLAST
Comparing Dsui_3415 FitnessBrowser__PS:Dsui_3415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 93% coverage: 15:467/486 of query aligns to 7:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P81), G75 (= G83), S76 (≠ A84), G77 (≠ A85), T78 (= T86), G79 (= G87), L80 (= L88), A83 (≠ G91), C84 (≠ A92), P137 (= P145), G138 (≠ S146), E139 (≠ S147), A142 (= A150), T143 (= T152), G146 (= G155), N147 (= N156), S149 (= S158), T150 (≠ E159), A152 (≠ S161), G153 (= G162), E203 (= E211), G204 (= G212), I209 (= I217), E422 (= E427), H423 (= H428)
- binding fe (iii) ion: H377 (= H383), H384 (= H390), E422 (= E427)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 89% coverage: 35:466/486 of query aligns to 24:453/459 of P9WIT1
- K354 (≠ E362) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
27% identity, 86% coverage: 53:469/486 of query aligns to 40:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), W323 (≠ F338), E414 (= E427), H415 (= H428), N451 (= N464)
- binding manganese (ii) ion: H370 (= H383), H377 (= H390), E414 (= E427)
- binding pyruvic acid: R319 (= R334), H370 (= H383), H377 (= H390), H415 (= H428)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
27% identity, 86% coverage: 53:469/486 of query aligns to 40:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), W322 (≠ F338), E413 (= E427), H414 (= H428), N450 (= N464)
- binding lactic acid: R318 (= R334), H369 (= H383), H376 (= H390), H414 (= H428)
- binding manganese (ii) ion: H369 (= H383), H376 (= H390), E413 (= E427)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
28% identity, 97% coverage: 4:473/486 of query aligns to 56:521/521 of Q8N465
- S109 (≠ E62) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V80) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A84) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L100) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F106) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- 169:521 (vs. 122:473, 26% identical) natural variant: Missing (in D2HGA1; uncertain significance)
- C172 (≠ V125) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A142) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S158) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ M184) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G186) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ N323) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R334) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F338) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ D347) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 (vs. 348:473, 30% identical) natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- K401 (≠ L349) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ A368) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G375) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H383) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G385) to V: slight reduction in catalytic activity
- N439 (= N388) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H390) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L392) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I393) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ Y395) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E427) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H428) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G429) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), W322 (≠ F338), E413 (= E427), H414 (= H428), N450 (= N464)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R334), H369 (= H383), H376 (= H390), H414 (= H428)
- binding manganese (ii) ion: H369 (= H383), H376 (= H390), E413 (= E427)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
28% identity, 96% coverage: 4:471/486 of query aligns to 4:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ G45), P76 (= P81), G78 (= G83), G79 (≠ A84), N80 (≠ A85), T81 (= T86), G82 (= G87), M83 (≠ L88), G86 (= G91), S87 (≠ A92), L140 (≠ P145), A142 (≠ S147), C146 (= C151), H147 (≠ T152), G150 (= G155), N151 (= N156), A153 (≠ S158), T154 (≠ E159), G208 (= G212), I212 (≠ V216), I213 (= I217), E423 (= E427), N460 (= N464)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R334), H369 (= H383), H376 (= H390), H414 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), W322 (≠ F338), E413 (= E427), H414 (= H428), N450 (= N464)
- binding manganese (ii) ion: H369 (= H383), H376 (= H390), E413 (= E427)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L88), R317 (= R334), W321 (≠ F338), H368 (= H383), H375 (= H390), H413 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), W321 (≠ F338), Y322 (≠ P339), E412 (= E427), H413 (= H428), N449 (= N464)
- binding manganese (ii) ion: H368 (= H383), H375 (= H390), E412 (= E427)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
28% identity, 96% coverage: 4:471/486 of query aligns to 3:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R334), T337 (≠ F338), K348 (≠ L349), Y379 (≠ V381), H381 (= H383), H388 (= H390), H423 (= H428)
- binding flavin-adenine dinucleotide: W39 (≠ G45), P75 (= P81), Q76 (≠ R82), G77 (= G83), G78 (≠ A84), N79 (≠ A85), T80 (= T86), G81 (= G87), M82 (≠ L88), G85 (= G91), S86 (≠ A92), L139 (≠ P145), G140 (≠ S146), A141 (≠ S147), C145 (= C151), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (≠ E159), G157 (= G163), G207 (= G212), I212 (= I217), E422 (= E427), N459 (= N464)
- binding zinc ion: H381 (= H383), H388 (= H390), E422 (= E427)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
28% identity, 96% coverage: 4:471/486 of query aligns to 3:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ G45), P75 (= P81), G77 (= G83), G78 (≠ A84), N79 (≠ A85), T80 (= T86), G81 (= G87), G85 (= G91), S86 (≠ A92), L139 (≠ P145), G140 (≠ S146), A141 (≠ S147), C145 (= C151), H146 (≠ T152), G148 (= G154), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (≠ E159), A155 (≠ S161), E206 (= E211), G207 (= G212), I211 (≠ V216), I212 (= I217), E422 (= E427), N459 (= N464)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R334), T337 (≠ F338), K348 (≠ L349), Y379 (≠ V381), H381 (= H383), H388 (= H390), H423 (= H428)
- binding zinc ion: H381 (= H383), H388 (= H390), E422 (= E427)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
28% identity, 96% coverage: 4:471/486 of query aligns to 3:466/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ G45), P75 (= P81), G77 (= G83), G78 (≠ A84), N79 (≠ A85), T80 (= T86), G81 (= G87), G85 (= G91), S86 (≠ A92), L139 (≠ P145), G140 (≠ S146), A141 (≠ S147), C145 (= C151), H146 (≠ T152), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (≠ E159), A155 (≠ S161), G157 (= G163), E206 (= E211), G207 (= G212), I211 (≠ V216), I212 (= I217), E422 (= E427), N459 (= N464)
- binding d-malate: M82 (≠ L88), R333 (= R334), T337 (≠ F338), K348 (≠ L349), Y379 (≠ V381), H381 (= H383), H388 (= H390), E422 (= E427), H423 (= H428)
- binding zinc ion: H381 (= H383), H388 (= H390), E422 (= E427)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
28% identity, 96% coverage: 4:471/486 of query aligns to 3:466/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R334), T337 (≠ F338), K348 (≠ L349), Y379 (≠ V381), H381 (= H383), H388 (= H390), N390 (≠ L392), H423 (= H428)
- binding flavin-adenine dinucleotide: W39 (≠ G45), P75 (= P81), G77 (= G83), G78 (≠ A84), N79 (≠ A85), T80 (= T86), G81 (= G87), M82 (≠ L88), G85 (= G91), S86 (≠ A92), L139 (≠ P145), G140 (≠ S146), A141 (≠ S147), C145 (= C151), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (≠ E159), A155 (≠ S161), G157 (= G163), G207 (= G212), I212 (= I217), E422 (= E427), H423 (= H428)
- binding zinc ion: H381 (= H383), H388 (= H390), E422 (= E427)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
27% identity, 86% coverage: 53:469/486 of query aligns to 40:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R334), W322 (≠ F338), H369 (= H383), H376 (= H390), H414 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), W322 (≠ F338), E413 (= E427), N450 (= N464)
- binding manganese (ii) ion: H369 (= H383), H376 (= H390), E413 (= E427)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), H369 (= H383), E413 (= E427), N450 (= N464)
- binding deaminohydroxyvaline: R319 (= R334), H414 (= H428)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), Y324 (≠ P339), H370 (= H383), E414 (= E427), N451 (= N464)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R334), W323 (≠ F338), H415 (= H428)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R334), W323 (≠ F338), H370 (= H383), H415 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), H370 (= H383), E414 (= E427), N451 (= N464)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R334), W323 (≠ F338), H415 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), Y324 (≠ P339), H370 (= H383), E414 (= E427), N451 (= N464)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), H370 (= H383), E414 (= E427), N451 (= N464)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R334), W323 (≠ F338), H415 (= H428)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
26% identity, 86% coverage: 53:469/486 of query aligns to 40:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P81), G70 (= G83), T71 (≠ A84), G72 (≠ A85), T73 (= T86), G74 (= G87), G78 (= G91), V79 (≠ A92), L90 (= L103), P132 (= P145), G133 (≠ S146), A134 (≠ S147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (≠ E159), A146 (≠ S161), S147 (≠ G162), E200 (= E211), G201 (= G212), I206 (= I217), H370 (= H383), E414 (= E427), N451 (= N464)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R334), H415 (= H428)
Query Sequence
>Dsui_3415 FitnessBrowser__PS:Dsui_3415
MGDRLPDSPDFAVDQAALLAALGRILPPGRVYGEPEDLRPYECDGLTAYRNLPLAVALPE
TEAEVQAILQLCHRLQVPVVPRGAATGLSGGAMPHHQGLLLSLAKFKKILKVDPVARTAL
VQPGVRNLAVSEAAAPYNLYYAPDPSSQIACTIGGNVSENSGGVHCLKYGLTVHNVLQVR
GYTMAGEAVTFGSAALDAPGFDLLALLNGSEGMLAVITEVLVKLTPKPQVAKVVLAYFDS
VTKAGNAVAEVIAAGIIPAGLEMMDKPATHAVEPYVKAGYDLDAEAVLLCESDGTPEEVE
EEIAAMRAVLEKSGATSLRVSANEAERLRFWAGRKAAFPAVGRITPDYLCMDGTIPRKRV
AEMLTAIAAMEKKYGLRCANVFHAGDGNLHPLIMYDANQPGELEQATAFGAEILELSVAL
GGSITGEHGVGVEKITQMCAQFTPEELARFEGVKQSFDPAGLLNPGKAIPTPARCREYRQ
TRGEKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory