SitesBLAST
Comparing Dsui_3436 FitnessBrowser__PS:Dsui_3436 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
40% identity, 94% coverage: 11:288/296 of query aligns to 16:288/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G15), L21 (= L16), G22 (= G17), I23 (≠ V18), M24 (= M19), N43 (≠ G38), R44 (= R39), T45 (≠ R40), K48 (≠ S43), V77 (= V72), S78 (≠ T73), D82 (= D77), Q85 (≠ S80), V133 (= V128), F244 (≠ I239), K245 (≠ E240), H248 (≠ L243), K251 (= K246)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
40% identity, 94% coverage: 11:288/296 of query aligns to 16:285/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G15), L21 (= L16), G22 (= G17), I23 (≠ V18), M24 (= M19), N43 (≠ G38), R44 (= R39), T45 (≠ R40), K48 (≠ S43), M76 (≠ V71), V77 (= V72), S78 (≠ T73), D82 (= D77), Q85 (≠ S80), V133 (= V128), F241 (≠ I239), K242 (≠ E240), H245 (≠ L243), K248 (= K246)
- binding sulfate ion: T134 (≠ S129), G135 (= G130), K183 (= K178)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
35% identity, 96% coverage: 11:293/296 of query aligns to 4:286/287 of 3pduA
- binding glycerol: R242 (≠ G249), E246 (≠ A253), E246 (≠ A253), R250 (≠ A257)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), G10 (= G17), I11 (≠ V18), M12 (= M19), N31 (≠ G38), R32 (= R39), N33 (≠ R40), M64 (≠ V71), L65 (≠ V72), A66 (≠ T73), A70 (≠ D77), T96 (= T103), V121 (= V128), G123 (= G130), T124 (≠ G131), K171 (= K178), S231 (≠ G238), F232 (≠ I239), P233 (≠ E240), H236 (≠ L243), K239 (= K246)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
32% identity, 96% coverage: 11:293/296 of query aligns to 4:286/287 of 3pefA
- binding glycerol: D67 (≠ S74), G123 (= G130), K171 (= K178), N175 (≠ Q182), M178 (= M185), L203 (≠ R210), G207 (≠ L214), N213 (≠ S220), A217 (≠ E224), F232 (≠ I239), H236 (≠ L243), K239 (= K246), R242 (≠ G249), R269 (≠ M276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G17), I11 (≠ V18), M12 (= M19), N31 (≠ G38), R32 (= R39), S33 (≠ R40), K36 (≠ S43), M64 (≠ V71), L65 (≠ V72), A66 (≠ T73), A70 (≠ D77), E73 (≠ S80), T96 (= T103), V121 (= V128), G123 (= G130), S124 (≠ G131), A231 (≠ G238), F232 (≠ I239), H236 (≠ L243), K239 (= K246)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
37% identity, 96% coverage: 11:293/296 of query aligns to 4:293/298 of Q9I5I6
- P66 (≠ T73) binding
- T96 (= T103) binding ; mutation to A: Almost abolished activity.
- S122 (= S129) mutation to A: Strongly reduced activity.
- K171 (= K178) active site
- N175 (≠ Q182) mutation to A: Strongly reduced activity.
- W214 (≠ R221) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K246) binding ; mutation to A: Almost abolished activity.
- D247 (= D247) mutation to A: Almost abolished activity.
Sites not aligning to the query:
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
33% identity, 98% coverage: 4:292/296 of query aligns to 34:329/335 of P29266
- D68 (≠ G38) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K178) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q182) mutation to Q: Decrease in activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
37% identity, 96% coverage: 11:293/296 of query aligns to 3:291/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G17), H10 (≠ V18), M11 (= M19), F29 (≠ W37), D30 (≠ G38), L31 (≠ R39), M63 (≠ V71), L64 (≠ V72), P65 (≠ T73), T94 (= T103), V119 (= V128), G121 (= G130), F237 (≠ I239), K244 (= K246)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
37% identity, 96% coverage: 11:293/296 of query aligns to 4:292/295 of 3obbA
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
33% identity, 95% coverage: 10:290/296 of query aligns to 3:284/298 of P0A9V8
- QM 11:12 (≠ VM 18:19) binding
- D31 (≠ G38) binding
- L65 (≠ V72) binding
- T96 (= T103) binding
- G122 (≠ S129) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G130) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G131) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQMIM 181:185) binding
- K240 (= K246) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
33% identity, 95% coverage: 10:290/296 of query aligns to 2:283/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
33% identity, 95% coverage: 10:290/296 of query aligns to 2:283/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G17), Q10 (≠ V18), M11 (= M19), F29 (≠ W37), D30 (≠ G38), V31 (≠ R39), M63 (≠ V71), L64 (≠ V72), V73 (= V81), S94 (= S102), T95 (= T103), R122 (≠ G130)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 98% coverage: 4:293/296 of query aligns to 35:331/336 of P31937
- 40:68 (vs. 9:37, 59% identical) binding
- LP 103:104 (≠ VT 72:73) binding
- N108 (≠ D77) binding
- T134 (= T103) binding
- K284 (= K246) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 95% coverage: 11:292/296 of query aligns to 3:291/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G17), N10 (≠ V18), M11 (= M19), Y29 (≠ W37), D30 (≠ G38), V31 (≠ R39), M63 (≠ V71), L64 (≠ V72), P65 (≠ T73), T95 (= T103), V120 (= V128), G122 (= G130), F238 (≠ I239), K245 (= K246)
2uyyA Structure of the cytokine-like nuclear factor n-pac
30% identity, 95% coverage: 11:290/296 of query aligns to 9:288/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G17), L16 (≠ V18), M17 (= M19), N36 (≠ G38), R37 (= R39), T38 (≠ R40), V70 (= V72), S71 (≠ T73), A75 (≠ D77), T101 (= T103), F237 (≠ I239), Y238 (≠ E240), Y241 (≠ L243), K244 (= K246)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
30% identity, 95% coverage: 11:290/296 of query aligns to 270:549/553 of Q49A26
- 271:285 (vs. 12:26, 47% identical) binding
- T362 (= T103) binding
- M437 (= M183) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ A237) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K246) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
31% identity, 95% coverage: 11:290/296 of query aligns to 269:542/546 of Q922P9
- P489 (≠ A237) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
28% identity, 95% coverage: 11:290/296 of query aligns to 6:287/294 of 5je8B
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
33% identity, 97% coverage: 11:296/296 of query aligns to 3:283/288 of 1wp4A
- active site: S116 (= S129), K164 (= K178), N167 (= N181), N168 (≠ Q182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G15), L8 (= L16), G9 (= G17), A10 (≠ V18), M11 (= M19), N29 (≠ G38), R30 (= R39), T31 (≠ R40), K34 (≠ A42), C61 (≠ V71), L62 (≠ V72), P63 (≠ T73), E67 (≠ D77), S90 (≠ T103), V115 (= V128), T225 (≠ G238), F226 (≠ I239), K233 (= K246)
- binding sulfate ion: S116 (= S129), G117 (= G130), G118 (= G131), K164 (= K178)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
33% identity, 97% coverage: 11:296/296 of query aligns to 4:284/289 of 2cvzC
- active site: S117 (= S129), K165 (= K178), N168 (= N181), N169 (≠ Q182)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), L9 (= L16), G10 (= G17), A11 (≠ V18), M12 (= M19), N30 (≠ G38), R31 (= R39), T32 (≠ R40), C62 (≠ V71), L63 (≠ V72), P64 (≠ T73), E68 (≠ D77), E71 (≠ S80), S91 (≠ T103), V116 (= V128), F227 (≠ I239), K234 (= K246)
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
31% identity, 96% coverage: 11:295/296 of query aligns to 3:290/292 of 5y8iA
Query Sequence
>Dsui_3436 FitnessBrowser__PS:Dsui_3436
MTASSSAKPAVGFIGLGVMGRPMAGHLLDAGYPLTVWGRRPASTAPLAEMGAAVAATPAE
VGRRAEIVFTVVTSGSDVKSVVLGEAGLIEGLAPGCVVVDMSTIAPGDAREIAAALAARG
IHFLDAPVSGGEQGAIHATLAIMAGGDAAVLERVKPLLLRLGKTVVHIGDNGAGQVAKAC
NQMIMVAAIQACAEAMHLAAASGVDTSRLREALLGGSAGSRVLEVMGERMAERDFAAGIE
ARLHHKDFGILLAEAHALGAPLPVAAQVGQQLNALMGQGMGKDDTSSLLRVLEGKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory