SitesBLAST
Comparing Dsui_3438 FitnessBrowser__PS:Dsui_3438 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
44% identity, 92% coverage: 1:275/299 of query aligns to 14:284/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (= I10), M24 (= M11), N43 (≠ A30), R44 (= R31), T45 (≠ R32), K48 (≠ S35), V77 (= V64), S78 (≠ A65), D82 (= D69), Q85 (= Q72), V133 (= V124), F244 (= F235), K245 (= K236), H248 (≠ M239), K251 (= K242)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
44% identity, 92% coverage: 1:275/299 of query aligns to 14:281/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (= I10), M24 (= M11), N43 (≠ A30), R44 (= R31), T45 (≠ R32), K48 (≠ S35), M76 (= M63), V77 (= V64), S78 (≠ A65), D82 (= D69), Q85 (= Q72), V133 (= V124), F241 (= F235), K242 (= K236), H245 (≠ M239), K248 (= K242)
- binding sulfate ion: T134 (≠ S125), G135 (= G126), K183 (= K174)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
36% identity, 96% coverage: 4:289/299 of query aligns to 5:286/287 of 3pduA
- binding glycerol: R242 (≠ N245), E246 (≠ Q249), E246 (≠ Q249), R250 (≠ E253)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G10 (= G9), I11 (= I10), M12 (= M11), N31 (≠ A30), R32 (= R31), N33 (≠ R32), M64 (= M63), L65 (≠ V64), A66 (= A65), A70 (≠ D69), T96 (= T99), V121 (= V124), G123 (= G126), T124 (≠ G127), K171 (= K174), S231 (≠ G234), F232 (= F235), P233 (≠ K236), H236 (≠ M239), K239 (= K242)
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
32% identity, 97% coverage: 1:290/299 of query aligns to 1:293/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ I10), M11 (= M11), Y29 (≠ W29), D30 (≠ A30), V31 (≠ R31), M63 (= M63), L64 (≠ V64), P65 (≠ A65), T95 (= T99), V120 (= V124), G122 (= G126), F238 (= F235), K245 (= K242)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
32% identity, 96% coverage: 3:290/299 of query aligns to 41:331/335 of P29266
- D68 (≠ A30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K174) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q178) mutation to Q: Decrease in activity.
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
32% identity, 96% coverage: 3:290/299 of query aligns to 42:332/336 of P31937
- LP 103:104 (≠ VA 64:65) binding
- N108 (≠ D69) binding
- T134 (= T99) binding
- K284 (= K242) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
33% identity, 97% coverage: 2:290/299 of query aligns to 3:287/287 of 3pefA
- binding glycerol: D67 (= D66), G123 (= G126), K171 (= K174), N175 (≠ Q178), M178 (≠ T181), L203 (≠ R206), G207 (≠ L210), N213 (≠ S216), A217 (≠ E220), F232 (= F235), H236 (≠ M239), K239 (= K242), R242 (≠ N245), R269 (≠ V272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (= I10), M12 (= M11), N31 (≠ A30), R32 (= R31), S33 (≠ R32), K36 (≠ S35), M64 (= M63), L65 (≠ V64), A66 (= A65), A70 (≠ D69), E73 (≠ Q72), T96 (= T99), V121 (= V124), G123 (= G126), S124 (≠ G127), A231 (≠ G234), F232 (= F235), H236 (≠ M239), K239 (= K242)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
31% identity, 95% coverage: 2:286/299 of query aligns to 5:287/294 of 5je8B
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
31% identity, 98% coverage: 3:295/299 of query aligns to 3:292/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ I10), M11 (= M11), F29 (≠ W29), D30 (≠ A30), V31 (≠ R31), M63 (= M63), L64 (≠ V64), V73 (= V73), S94 (= S98), T95 (= T99), R122 (≠ G126)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
31% identity, 98% coverage: 3:295/299 of query aligns to 4:293/298 of P0A9V8
- QM 11:12 (≠ IM 10:11) binding
- D31 (≠ A30) binding
- L65 (≠ V64) binding
- T96 (= T99) binding
- G122 (≠ S125) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G126) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G127) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQIVT 177:181) binding
- K240 (= K242) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
31% identity, 98% coverage: 3:295/299 of query aligns to 3:292/294 of 6smyA
2uyyA Structure of the cytokine-like nuclear factor n-pac
30% identity, 95% coverage: 2:286/299 of query aligns to 8:288/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ I10), M17 (= M11), N36 (≠ A30), R37 (= R31), T38 (≠ R32), V70 (= V64), S71 (≠ A65), A75 (≠ D69), T101 (= T99), F237 (= F235), Y238 (≠ K236), Y241 (≠ M239), K244 (= K242)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
30% identity, 95% coverage: 2:286/299 of query aligns to 269:549/553 of Q49A26
- 271:285 (vs. 4:18, 53% identical) binding
- T362 (= T99) binding
- M437 (≠ K174) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P233) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K242) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
35% identity, 98% coverage: 2:294/299 of query aligns to 3:298/298 of Q9I5I6
- P66 (≠ A65) binding
- T96 (= T99) binding ; mutation to A: Almost abolished activity.
- S122 (= S125) mutation to A: Strongly reduced activity.
- K171 (= K174) active site
- N175 (≠ Q178) mutation to A: Strongly reduced activity.
- W214 (≠ F213) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K242) binding ; mutation to A: Almost abolished activity.
- D247 (= D243) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
34% identity, 96% coverage: 2:289/299 of query aligns to 3:292/295 of 3obbA
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
30% identity, 95% coverage: 2:286/299 of query aligns to 268:542/546 of Q922P9
- P489 (= P233) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
35% identity, 96% coverage: 2:289/299 of query aligns to 2:291/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ I10), M11 (= M11), F29 (≠ W29), D30 (≠ A30), L31 (≠ R31), M63 (= M63), L64 (≠ V64), P65 (≠ A65), T94 (= T99), V119 (= V124), G121 (= G126), F237 (= F235), K244 (= K242)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
33% identity, 98% coverage: 2:293/299 of query aligns to 2:284/288 of 1wp4A
- active site: S116 (= S125), K164 (= K174), N167 (= N177), N168 (≠ Q178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), L8 (= L8), G9 (= G9), A10 (≠ I10), M11 (= M11), N29 (≠ A30), R30 (= R31), T31 (≠ R32), K34 (≠ S35), C61 (≠ M63), L62 (≠ V64), P63 (≠ A65), E67 (≠ D69), S90 (≠ T99), V115 (= V124), T225 (≠ G234), F226 (= F235), K233 (= K242)
- binding sulfate ion: S116 (= S125), G117 (= G126), G118 (= G127), K164 (= K174)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
33% identity, 98% coverage: 2:293/299 of query aligns to 3:285/289 of 2cvzC
- active site: S117 (= S125), K165 (= K174), N168 (= N177), N169 (≠ Q178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (= L8), G10 (= G9), A11 (≠ I10), M12 (= M11), N30 (≠ A30), R31 (= R31), T32 (≠ R32), C62 (≠ M63), L63 (≠ V64), P64 (≠ A65), E68 (≠ D69), E71 (≠ Q72), S91 (≠ T99), V116 (= V124), F227 (= F235), K234 (= K242)
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
27% identity, 95% coverage: 3:285/299 of query aligns to 318:597/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
Query Sequence
>Dsui_3438 FitnessBrowser__PS:Dsui_3438
MEIGFIGLGIMGRPMALNLLKGGHGVHVWARRPESMAPLLEAGAVGCSSPAAVAGQVEVV
ISMVADAPDVAQVMLGPDGVAAGAEGAGKHGLVAVDMSTIAPAAARDLAARLQARGVDFV
DAPVSGGEVGAIAGSLSIMAGGSAEAFAKALPAFLCLGQNVVHVGAAGAGQVAKACNQIV
TGMGVLAVAEAFNFARQAGVDPAKVREALLGGFAYSRILENHGQRMLERNFKPGFKSWMH
QKDLNIVMQSAHELGLCLPGAAATAQMFNAMVGSGLEEEDSVAVLKLLERLSGRTDGAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory