SitesBLAST
Comparing Echvi_0060 FitnessBrowser__Cola:Echvi_0060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
45% identity, 57% coverage: 257:613/624 of query aligns to 2:339/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G286), G34 (= G289), T35 (≠ S290), I36 (= I291), D56 (= D311), H57 (≠ K312), S82 (≠ D339), I83 (= I340), A104 (= A361), A105 (= A362), A106 (= A363), K108 (= K365), N123 (≠ S380), I146 (≠ V403), K162 (= K419), F184 (= F448), G185 (= G449), N186 (= N450), V187 (= V451), S190 (= S454), S191 (≠ N455)
- binding uridine-5'-diphosphate: K150 (= K407), N186 (= N450), S193 (= S457), V194 (= V458), T209 (≠ M473), L210 (≠ V474), T211 (= T475), I215 (= I479), R217 (= R481), E279 (= E546)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
45% identity, 57% coverage: 257:613/624 of query aligns to 2:339/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G286), G34 (= G289), T35 (≠ S290), I36 (= I291), D56 (= D311), H57 (≠ K312), S82 (≠ D339), I83 (= I340), A104 (= A361), A105 (= A362), A106 (= A363), K108 (= K365), N123 (≠ S380), I146 (≠ V403), K162 (= K419), F184 (= F448), G185 (= G449), N186 (= N450), V187 (= V451), S190 (= S454), S191 (≠ N455)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K365), H109 (= H366), T148 (= T405), G185 (= G449), N186 (= N450), S193 (= S457), V194 (= V458), T209 (≠ M473), L210 (≠ V474), T211 (= T475), I215 (= I479), R217 (= R481), R276 (= R543), E279 (= E546)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
37% identity, 47% coverage: 279:570/624 of query aligns to 5:289/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G286), T14 (≠ A288), G15 (= G289), T16 (≠ S290), I17 (= I291), S37 (≠ D311), R38 (≠ K312), S39 (≠ A313), D63 (= D339), I64 (= I340), V83 (≠ A361), A84 (= A362), K87 (= K365), T125 (≠ V403), S127 (≠ T405), Y137 (≠ M415), K141 (= K419), F167 (= F448), V170 (= V451), S173 (= S454), R174 (≠ N455)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K365), H88 (= H366), S127 (≠ T405), N128 (≠ D406), Y137 (≠ M415), N169 (= N450), S176 (= S457), V177 (= V458), L180 (= L461), T192 (≠ M473), T194 (= T475), M198 (≠ I479), R200 (= R481), L234 (≠ I516), E265 (= E546)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
37% identity, 45% coverage: 279:560/624 of query aligns to 4:272/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G286), T13 (≠ A288), G14 (= G289), S15 (= S290), F16 (≠ I291), S36 (≠ D311), R37 (≠ K312), D38 (≠ A313), K41 (≠ A316), D60 (= D339), V61 (≠ I340), A80 (= A361), A81 (= A362), A82 (= A363), K84 (= K365), T99 (≠ S380), L122 (≠ V403), K138 (= K419), Y164 (≠ F448)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
32% identity, 45% coverage: 279:560/624 of query aligns to 13:280/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K365), Q94 (≠ H366), N175 (= N450), S179 (= S454), R180 (≠ N455), S182 (= S457), V183 (= V458), L186 (= L461), T198 (≠ M473), I199 (≠ V474), T200 (= T475), M204 (≠ I479), R206 (= R481), V240 (≠ I516), R263 (= R543), E266 (= E546)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
32% identity, 45% coverage: 279:560/624 of query aligns to 13:280/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G286), T22 (≠ A288), G23 (= G289), S24 (= S290), F25 (≠ I291), S45 (≠ D311), R46 (≠ K312), D47 (≠ A313), K50 (≠ A316), D69 (= D339), V70 (≠ I340), A89 (= A361), A90 (= A362), A91 (= A363), K93 (= K365), L131 (≠ V403), T133 (= T405), K147 (= K419), Y173 (≠ F448)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H366), V95 (= V367), K135 (= K407), N175 (= N450), S182 (= S457), V183 (= V458), L186 (= L461), T198 (≠ M473), T200 (= T475), M204 (≠ I479), V240 (≠ I516), R263 (= R543), E266 (= E546), Y278 (≠ Q558)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 313, 314, 315, 316, 320
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
31% identity, 45% coverage: 278:560/624 of query aligns to 4:272/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G286), T14 (≠ A288), G15 (= G289), F17 (≠ I291), S37 (≠ D311), R38 (≠ K312), D39 (≠ A313), K42 (≠ A316), D61 (= D339), V62 (≠ I340), R63 (= R341), A81 (= A361), A82 (= A362), A83 (= A363), K85 (= K365), S124 (= S404), T125 (= T405), K139 (= K419), Y165 (≠ F448), G166 (= G449)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
30% identity, 45% coverage: 277:557/624 of query aligns to 2:266/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G286), T13 (≠ A288), G14 (= G289), S15 (= S290), F16 (≠ I291), S37 (≠ D311), R38 (≠ K312), D39 (≠ A313), K42 (≠ A316), D61 (= D339), V62 (≠ I340), A81 (= A361), A82 (= A362), A83 (= A363), K85 (= K365), T100 (≠ S380), L123 (≠ V403), S124 (= S404), K139 (= K419), Y165 (≠ F448), G166 (= G449), V168 (= V451), S171 (= S454), R172 (≠ N455)
- binding uridine-5'-diphosphate: K127 (= K407), N167 (= N450), V175 (= V458), P191 (≠ M473), I192 (≠ V474), T193 (= T475), M197 (≠ I479), R199 (= R481), M233 (≠ I516), R252 (= R543)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
30% identity, 45% coverage: 275:557/624 of query aligns to 2:268/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K365), S176 (= S457), V177 (= V458), T195 (= T475), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R543), E257 (= E546)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G286), T15 (≠ A288), G16 (= G289), S17 (= S290), F18 (≠ I291), S39 (≠ D311), R40 (≠ K312), D41 (≠ A313), K44 (≠ A316), D63 (= D339), V64 (≠ I340), A83 (= A361), A84 (= A362), A85 (= A363), K87 (= K365), L125 (≠ V403), S126 (= S404), Y137 (≠ M415), K141 (= K419), Y167 (≠ F448), G168 (= G449), V170 (= V451)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
30% identity, 45% coverage: 275:557/624 of query aligns to 2:268/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G286), T15 (≠ A288), G16 (= G289), S17 (= S290), F18 (≠ I291), R40 (≠ K312), D41 (≠ A313), K44 (≠ A316), D63 (= D339), V64 (≠ I340), A83 (= A361), A84 (= A362), A85 (= A363), K87 (= K365), L125 (≠ V403), S126 (= S404), K141 (= K419), Y167 (≠ F448), G168 (= G449), V170 (= V451), R174 (≠ N455)
- binding uridine-5'-diphosphate-glucose: K87 (= K365), T127 (= T405), K129 (= K407), Y137 (≠ M415), N169 (= N450), S176 (= S457), V177 (= V458), P193 (≠ M473), T195 (= T475), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R543), E257 (= E546)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
30% identity, 45% coverage: 275:557/624 of query aligns to 2:268/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G286), T15 (≠ A288), G16 (= G289), S17 (= S290), F18 (≠ I291), R40 (≠ K312), D41 (≠ A313), K44 (≠ A316), D63 (= D339), V64 (≠ I340), A84 (= A362), A85 (= A363), K87 (= K365), S126 (= S404), Y137 (≠ M415), K141 (= K419), Y167 (≠ F448), G168 (= G449), V170 (= V451), S173 (= S454), R174 (≠ N455)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K365), D128 (= D406), K129 (= K407), N169 (= N450), G175 (= G456), S176 (= S457), V177 (= V458), P193 (≠ M473), I194 (≠ V474), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R543), E257 (= E546)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
30% identity, 45% coverage: 275:557/624 of query aligns to 2:268/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G286), T15 (≠ A288), G16 (= G289), S17 (= S290), F18 (≠ I291), S39 (≠ D311), R40 (≠ K312), D41 (≠ A313), K44 (≠ A316), D63 (= D339), V64 (≠ I340), A83 (= A361), A84 (= A362), A85 (= A363), K87 (= K365), T102 (≠ S380), L125 (≠ V403), S126 (= S404), T127 (= T405), Y137 (≠ M415), K141 (= K419), Y167 (≠ F448), G168 (= G449), V170 (= V451), S173 (= S454), R174 (≠ N455)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K365), T127 (= T405), D128 (= D406), K129 (= K407), Y137 (≠ M415), N169 (= N450), S176 (= S457), V177 (= V458), P193 (≠ M473), T195 (= T475), M199 (≠ I479), R201 (= R481), M235 (≠ I516), R254 (= R543), E257 (= E546)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
30% identity, 46% coverage: 271:557/624 of query aligns to 2:272/333 of O25511
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
28% identity, 46% coverage: 275:560/624 of query aligns to 1:253/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G286), S14 (≠ A288), G15 (= G289), S16 (= S290), L17 (≠ I291), R36 (≠ K312), D37 (≠ A313), D59 (= D339), I60 (= I340), A81 (= A361), A82 (= A362), A83 (= A363), K85 (= K365), V128 (= V403), Y140 (≠ M415), K144 (= K419), Y168 (≠ F448), G169 (= G449), V171 (= V451)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
27% identity, 37% coverage: 279:507/624 of query aligns to 3:198/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G286), T12 (≠ A288), G13 (= G289), S14 (= S290), F15 (≠ I291), S35 (≠ D311), R36 (≠ K312), D37 (≠ A313), K40 (≠ A316), D59 (= D339), V60 (≠ I340), A80 (= A362), A81 (= A363), K83 (= K365), L121 (≠ V403), T123 (= T405), K137 (= K419), Y163 (≠ F448), G164 (= G449)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 41% coverage: 265:520/624 of query aligns to 16:266/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G289), S41 (= S290), I42 (= I291), D62 (= D311), I63 (≠ K312), D92 (= D339), I93 (= I340), L114 (≠ A361), S115 (≠ A362), A116 (= A363), K118 (= K365), V158 (= V403), D161 (= D406), K174 (= K419), V198 (= V451), S201 (= S454)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 44% coverage: 261:533/624 of query aligns to 10:267/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G289), S39 (= S290), I40 (= I291), D60 (= D311), I61 (≠ K312), L89 (≠ A338), D90 (= D339), I91 (= I340), L112 (≠ A361), S113 (≠ A362), A114 (= A363), K116 (= K365), D159 (= D406), K172 (= K419), N195 (= N450), V196 (= V451), S199 (= S454)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 46% coverage: 282:567/624 of query aligns to 3:291/309 of 4zrnA
- active site: T117 (= T405), G119 (≠ K407), A120 (= A408), Y143 (≠ M415), K147 (= K419), Y181 (vs. gap), G185 (≠ S457)
- binding nicotinamide-adenine-dinucleotide: G7 (= G286), G10 (= G289), F11 (≠ S290), I12 (= I291), D31 (= D311), N32 (≠ K312), S34 (≠ E314), S35 (= S315), G36 (≠ A316), S51 (≠ D339), I52 (= I340), L73 (≠ A361), A74 (= A362), A75 (= A363), T92 (≠ S380), S115 (≠ V403), S116 (= S404), Y143 (≠ M415), K147 (= K419), Y170 (≠ F448), V173 (= V451)
- binding uridine-5'-diphosphate-glucose: T117 (= T405), G119 (≠ K407), A120 (= A408), Y143 (≠ M415), N172 (= N450), G185 (≠ S457), V186 (= V458), H201 (≠ M473), F203 (vs. gap), Y208 (≠ I479), R210 (= R481), V244 (≠ I516), R267 (= R543), D270 (≠ E546)
1z45A Crystal structure of the gal10 fusion protein galactose mutarotase/udp-galactose 4-epimerase from saccharomyces cerevisiae complexed with NAD, udp-glucose, and galactose (see paper)
26% identity, 39% coverage: 280:524/624 of query aligns to 2:243/674 of 1z45A
- active site: S125 (≠ T405), A126 (vs. gap), T127 (vs. gap), Y153 (≠ M415), K157 (= K419)
- binding nicotinamide-adenine-dinucleotide: G8 (= G286), G11 (= G289), Y12 (≠ S290), I13 (= I291), D32 (= D311), N33 (≠ K312), L34 (≠ A313), S35 (≠ E314), N36 (≠ S315), S37 (≠ A316), D59 (= D339), L60 (≠ I340), F81 (≠ A361), A82 (= A362), G83 (≠ A363), K85 (= K365), N100 (≠ S380), S123 (≠ V403), S124 (= S404), S125 (≠ T405), Y153 (≠ M415), K157 (= K419), Y182 (≠ F448), P185 (≠ V451)
- binding uridine-5'-diphosphate-glucose: S125 (≠ T405), Y153 (≠ M415), F183 (≠ G449), N184 (= N450), N203 (≠ E488), N204 (≠ A489), L205 (≠ C490), Y221 (≠ F506), F223 (= F508), P228 (= P513), R230 (≠ K515), Y232 (vs. gap)
Sites not aligning to the query:
- active site: 433, 512, 640
- binding beta-D-galactopyranose: 407, 408, 433, 512, 514, 574, 622, 640
- binding uridine-5'-diphosphate-glucose: 272, 293
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
29% identity, 20% coverage: 282:407/624 of query aligns to 3:135/361 of 1kewA
- active site: T133 (= T405), D134 (= D406), E135 (≠ K407)
- binding nicotinamide-adenine-dinucleotide: G10 (= G289), F11 (≠ S290), I12 (= I291), D32 (= D311), K33 (= K312), L34 (≠ A313), T35 (≠ E314), A37 (= A316), G38 (vs. gap), D58 (= D339), I59 (= I340), L80 (≠ A361), A81 (= A362), A82 (= A363), S84 (≠ K365), T99 (≠ S380), I131 (≠ V403), S132 (= S404), T133 (= T405)
- binding thymidine-5'-diphosphate: E135 (≠ K407)
Sites not aligning to the query:
- active site: 152, 154, 155, 158, 167, 171
- binding nicotinamide-adenine-dinucleotide: 167, 171, 194, 196, 197
- binding thymidine-5'-diphosphate: 196, 206, 207, 222, 224, 231, 266, 297, 300, 357
Query Sequence
>Echvi_0060 FitnessBrowser__Cola:Echvi_0060
MIKWITRTIDSVILFHSIVLAYFLRFNFEWEVIHQYPVLDSGLLFMFLGVGAMLLTEKEK
WLGSRSRIGNFALVAHTVMVALMLASLACLVTEKLVLKAPFVPISVLVIGALLAYFFMSL
YRLFVKEFYGMYLKKKQPQKHIVIFGAGEAGRLSKTVLGSQVGSNQKIHAFLDDDMQKAG
GSIGGIPVYHGLDRLKTLQRDHAISDLLISIMCISPRRKKEIIEECLQLGIKVSVVPSID
EWVKGGFNVGKIRQIKIEDLLSRPEISLDNPAVFSQISDRVVMVTGAAGSIGSELCRKII
EHKPALLIMVDKAESALYDVEQEFRSGRWKSQIKPILADIRDAKKMDRIFKMYKPAIVYH
AAAYKHVPMMENYPEEAVTSNVLATKNLADLSVLHNVSQFVFVSTDKAVNPTNVMGASKR
IAEIYIQALSRYLDVEKGQVTKFAITRFGNVLGSNGSVIPLFKKQIEQGGPVMVTDPNIS
RYFMTISEACQLILEAGAMSTGNEIFIFDMGEPVKILDLAKKMIQLSDKKIGEDIKIVFT
GLREGEKLHEELLCHSEQLQITHHPKIRVVKMGDMAFSKVNYQIEFFERLLILSSDTEIV
RHIKHIVPEYVSNTSRYHVLDRLN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory