SitesBLAST
Comparing Echvi_0069 Echvi_0069 Enoyl-CoA hydratase/carnithine racemase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
38% identity, 93% coverage: 17:258/260 of query aligns to 16:254/257 of 6slbAAA
- active site: Q64 (= Q65), F69 (≠ V70), L80 (≠ R84), N84 (= N88), A108 (= A112), S111 (= S115), A130 (≠ M134), F131 (= F135), L136 (= L140), P138 (≠ M142), D139 (= D143), A224 (≠ E228), G234 (= G238)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ G59), A62 (≠ S63), Q64 (= Q65), D65 (= D66), L66 (= L67), Y76 (≠ K80), A108 (= A112), F131 (= F135), D139 (= D143)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 93% coverage: 17:258/260 of query aligns to 13:242/245 of 6slaAAA
- active site: Q61 (= Q65), L68 (≠ R84), N72 (= N88), A96 (= A112), S99 (= S115), A118 (≠ M134), F119 (= F135), L124 (= L140), P126 (≠ M142), N127 (≠ D143), A212 (≠ E228), G222 (= G238)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ F25), A59 (≠ S63), Q61 (= Q65), D62 (= D66), L63 (= L67), L68 (≠ R84), Y71 (= Y87), A94 (≠ V110), G95 (= G111), A96 (= A112), F119 (= F135), I122 (= I138), L124 (= L140), N127 (≠ D143), F234 (= F250), K237 (= K253)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
33% identity, 99% coverage: 1:258/260 of query aligns to 1:256/259 of 5zaiC
- active site: A65 (≠ Q65), F70 (≠ V70), S82 (≠ K80), R86 (= R84), G110 (≠ A112), E113 (≠ S115), P132 (≠ M134), E133 (≠ F135), I138 (≠ L140), P140 (≠ M142), G141 (≠ D143), A226 (≠ E228), F236 (≠ G238)
- binding coenzyme a: K24 (≠ V24), L25 (≠ F25), A63 (≠ S63), G64 (= G64), A65 (≠ Q65), D66 (= D66), I67 (≠ L67), P132 (≠ M134), R166 (≠ K168), F248 (= F250), K251 (= K253)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 99% coverage: 2:258/260 of query aligns to 2:257/260 of 2hw5C
- active site: A68 (≠ Q65), M73 (≠ L74), S83 (≠ R84), L87 (≠ N88), G111 (≠ A112), E114 (≠ S115), P133 (≠ M134), E134 (≠ F135), T139 (≠ L140), P141 (≠ M142), G142 (≠ D143), K227 (≠ E228), F237 (≠ G238)
- binding crotonyl coenzyme a: K26 (≠ A23), A27 (≠ V24), L28 (≠ F25), A30 (= A27), K62 (≠ G59), I70 (≠ L67), F109 (≠ V110)
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
33% identity, 93% coverage: 17:258/260 of query aligns to 28:268/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 99% coverage: 2:258/260 of query aligns to 32:287/290 of P14604
- E144 (≠ S115) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F135) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
30% identity, 99% coverage: 2:258/260 of query aligns to 2:257/260 of 1dubA
- active site: A68 (≠ Q65), M73 (≠ L74), S83 (≠ R84), L87 (≠ N88), G111 (≠ A112), E114 (≠ S115), P133 (≠ M134), E134 (≠ F135), T139 (≠ L140), P141 (≠ M142), G142 (≠ D143), K227 (≠ E228), F237 (≠ G238)
- binding acetoacetyl-coenzyme a: K26 (≠ A23), A27 (≠ V24), L28 (≠ F25), A30 (= A27), A66 (≠ S63), A68 (≠ Q65), D69 (= D66), I70 (≠ L67), Y107 (≠ A108), G110 (= G111), G111 (≠ A112), E114 (≠ S115), P133 (≠ M134), E134 (≠ F135), L137 (≠ I138), G142 (≠ D143), F233 (≠ Q234), F249 (= F250)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 98% coverage: 3:258/260 of query aligns to 1:255/258 of 1ey3A
- active site: A66 (≠ Q65), M71 (≠ L74), S81 (≠ R84), L85 (≠ N88), G109 (≠ A112), E112 (≠ S115), P131 (≠ M134), E132 (≠ F135), T137 (≠ L140), P139 (≠ M142), G140 (≠ D143), K225 (≠ E228), F235 (≠ G238)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ A23), L26 (≠ F25), A28 (= A27), A64 (≠ S63), G65 (= G64), A66 (≠ Q65), D67 (= D66), I68 (≠ L67), L85 (≠ N88), W88 (≠ I91), G109 (≠ A112), P131 (≠ M134), L135 (≠ I138), G140 (≠ D143)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 99% coverage: 2:258/260 of query aligns to 1:251/254 of 2dubA
- active site: A67 (≠ Q65), M72 (≠ L74), S82 (≠ R84), G105 (≠ A112), E108 (≠ S115), P127 (≠ M134), E128 (≠ F135), T133 (≠ L140), P135 (≠ M142), G136 (≠ D143), K221 (≠ E228), F231 (≠ G238)
- binding octanoyl-coenzyme a: K25 (≠ A23), A26 (≠ V24), L27 (≠ F25), A29 (= A27), A65 (≠ S63), A67 (≠ Q65), D68 (= D66), I69 (≠ L67), K70 (= K68), G105 (≠ A112), E108 (≠ S115), P127 (≠ M134), E128 (≠ F135), G136 (≠ D143), A137 (= A144)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
32% identity, 95% coverage: 13:258/260 of query aligns to 17:263/266 of O53561
- K135 (≠ Y130) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 130:137, 13% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ H137) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 99% coverage: 2:258/260 of query aligns to 2:255/258 of 1mj3A
- active site: A68 (≠ Q65), M73 (≠ L74), S83 (≠ N88), L85 (= L90), G109 (≠ A112), E112 (≠ S115), P131 (≠ M134), E132 (≠ F135), T137 (≠ L140), P139 (≠ M142), G140 (≠ D143), K225 (≠ E228), F235 (≠ G238)
- binding hexanoyl-coenzyme a: K26 (≠ A23), A27 (≠ V24), L28 (≠ F25), A30 (= A27), A66 (≠ S63), G67 (= G64), A68 (≠ Q65), D69 (= D66), I70 (≠ L67), G109 (≠ A112), P131 (≠ M134), E132 (≠ F135), L135 (≠ I138), G140 (≠ D143)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
29% identity, 99% coverage: 1:258/260 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (≠ Q65), M70 (≠ L74), T80 (≠ R84), F84 (≠ N88), G108 (≠ A112), E111 (≠ S115), P130 (≠ M134), E131 (≠ F135), V136 (≠ L140), P138 (≠ M142), G139 (≠ D143), L224 (≠ E228), F234 (≠ G238)
- binding acetoacetyl-coenzyme a: Q23 (≠ A23), A24 (≠ V24), L25 (≠ F25), A27 (= A27), A63 (≠ S63), G64 (= G64), A65 (≠ Q65), D66 (= D66), I67 (≠ L67), K68 (= K68), M70 (≠ L74), F84 (≠ N88), G107 (= G111), G108 (≠ A112), E111 (≠ S115), P130 (≠ M134), E131 (≠ F135), P138 (≠ M142), G139 (≠ D143), M140 (≠ A144)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
29% identity, 99% coverage: 1:258/260 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (≠ Q65), M70 (≠ L74), T80 (≠ R84), F84 (≠ N88), G108 (≠ A112), E111 (≠ S115), P130 (≠ M134), E131 (≠ F135), V136 (≠ L140), P138 (≠ M142), G139 (≠ D143), L224 (≠ E228), F234 (≠ G238)
- binding coenzyme a: L25 (≠ F25), A63 (≠ S63), I67 (≠ L67), K68 (= K68), Y104 (≠ A108), P130 (≠ M134), E131 (≠ F135), L134 (≠ I138)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
29% identity, 98% coverage: 3:258/260 of query aligns to 2:253/256 of 3h81A
- active site: A64 (≠ Q65), M69 (≠ L74), T79 (≠ R84), F83 (≠ N88), G107 (≠ A112), E110 (≠ S115), P129 (≠ M134), E130 (≠ F135), V135 (≠ L140), P137 (≠ M142), G138 (≠ D143), L223 (≠ E228), F233 (≠ G238)
- binding calcium ion: F233 (≠ G238), Q238 (≠ F243)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
29% identity, 98% coverage: 3:258/260 of query aligns to 2:249/250 of 3q0gD
- active site: A64 (≠ Q65), M69 (≠ V70), T75 (≠ R84), F79 (≠ N88), G103 (≠ A112), E106 (≠ S115), P125 (≠ M134), E126 (≠ F135), V131 (≠ L140), P133 (≠ M142), G134 (≠ D143), L219 (≠ E228), F229 (≠ G238)
- binding Butyryl Coenzyme A: F225 (≠ Q234), F241 (= F250)
A5JTM5 4-chlorobenzoyl coenzyme A dehalogenase; 4-CBA-CoA dehalogenase; 4-CBCoA dehalogenase; 4-chlorobenzoyl-CoA dehalogenase; EC 3.8.1.7 from Pseudomonas sp. (strain CBS-3) (see 7 papers)
27% identity, 97% coverage: 3:255/260 of query aligns to 2:257/269 of A5JTM5
- R24 (≠ F25) binding in other chain; mutation R->K,L: Does not strongly affect catalytic activity, but reduces substrate CoA binding.
- E34 (= E35) mutation to T: Forms inclusion bodies.
- E43 (≠ A44) mutation to A: No effect on catalytic activity.
- D45 (≠ A46) mutation to A: No effect on catalytic activity.
- D46 (≠ E47) mutation to A: No effect on catalytic activity.
- G63 (= G64) mutation G->A,I,P: Yields insoluble protein.
- F64 (≠ Q65) mutation to A: 30-fold reduction in catalytic activity, substrate benzoyl group binding is unaffected.; mutation to L: Retains catalytic activity, but substrate benzoyl group binding is decreased.; mutation to P: Severely reduces catalytic activity. Arylated intermediate does not accumulate.
- Y65 (≠ D66) mutation to D: Catalytic activity is almost as efficient as wild type.
- R67 (≠ K68) mutation to K: Reduces substrate CoA binding.; mutation to L: Forms inclusion bodies.
- E68 (≠ A69) mutation to T: No effect on catalytic activity.
- H81 (≠ I82) mutation to Q: Loss of catalytic activity, substrate benzoyl group binding is not affected.
- F82 (≠ I83) mutation to L: Retains catalytic activity, but substrate benzoyl group binding is decreased.
- W89 (≠ Y87) mutation to F: Retains catalytic activity, but substrate benzoyl group binding is decreased.; mutation to Y: Reduced activity and substrate benzoyl group binding.
- H90 (≠ N88) active site, Proton acceptor; mutation to Q: Complete loss of catalytic activity (PubMed:8718880, PubMed:9063883). Significantly reduced activity (PubMed:11695894). Substrate binding is not significantly affected. Reduced arylated intermediate formation.
- H94 (≠ I92) mutation to Q: No effect on catalytic activity.
- A112 (≠ V110) mutation to G: Yields insoluble protein.; mutation to S: Protein precipitates upon purification.; mutation to V: Catalytic activity is almost as efficient as wild type.
- G113 (= G111) mutation to A: Strongly reduced catalytic activity and substrate benzoyl group binding. Arylated intermediate does not accumulate.; mutation G->N,S: Strongly reduced catalytic activity. Arylated intermediate does not accumulate.; mutation to V: Protein precipitates upon purification.
- G114 (≠ A112) mutation to A: Strongly reduced catalytic activity and substrate benzoyl group binding.; mutation to P: Unstable.
- G115 (= G113) mutation G->L,N,S,V: Yields insoluble protein.
- D123 (= D121) mutation to T: No effect on catalytic activity.
- D129 (≠ K127) mutation to T: No effect on catalytic activity.
- W137 (≠ F135) mutation to F: Low catalytic activity, but KM unaffected (PubMed:8718880). Retains catalytic activity, but substrate benzoyl group binding is decreased (PubMed:9063883).
- D145 (= D143) active site, Nucleophile; mutation to A: Complete loss of catalytic activity, but not substrate binding.
- E163 (= E161) mutation to T: No effect on catalytic activity.
- E175 (= E173) mutation to D: No effect on catalytic activity.
- W179 (≠ L177) mutation to F: No effect on catalytic activity.
- H208 (≠ S206) mutation to Q: No effect on catalytic activity.
- R216 (≠ M214) mutation R->E,K,L: Yields insoluble protein.
- E232 (= E230) mutation E->A,N,Q,R: Yields insoluble protein.; mutation to D: Reduced catalytic activity, increased substrate binding.
- R257 (≠ K255) mutation to K: Retains catalytic activity and substrate CoA binding.; mutation to L: Significantly reduces catalytic activity and substrate CoA binding.
1nzyB 4-chlorobenzoyl coenzyme a dehalogenase from pseudomonas sp. Strain cbs-3 (see paper)
27% identity, 97% coverage: 3:255/260 of query aligns to 2:257/269 of 1nzyB
- active site: C61 (= C62), F64 (≠ Q65), I69 (≠ V70), A86 (vs. gap), H90 (≠ N88), G114 (≠ A112), G117 (≠ S115), A136 (≠ M134), W137 (≠ F135), I142 (≠ L140), N144 (≠ M142), D145 (= D143), E230 (= E228)
- binding 4-hydroxybenzoyl coenzyme a: R22 (≠ A23), H23 (≠ V24), R24 (≠ F25), A62 (≠ S63), F64 (≠ Q65), Y65 (≠ D66), L66 (= L67), R67 (≠ K68), W89 (≠ Y87), G113 (= G111), G114 (≠ A112), A136 (≠ M134), W137 (≠ F135), D145 (= D143), T146 (≠ A144), F252 (= F250), R257 (≠ K255)
- binding calcium ion: G49 (≠ R50), L202 (≠ Y200), A203 (≠ V201), A205 (= A203), T207 (≠ G205), Q210 (≠ I208)
- binding phosphate ion: E57 (≠ G58), N108 (= N106), K188 (≠ H186), R192 (≠ D190)
1jxzB Structure of the h90q mutant of 4-chlorobenzoyl-coenzyme a dehalogenase complexed with 4-hydroxybenzoyl-coenzyme a (product) (see paper)
27% identity, 97% coverage: 3:255/260 of query aligns to 2:257/269 of 1jxzB
- active site: C61 (= C62), F64 (≠ Q65), I69 (≠ V70), A86 (vs. gap), Q90 (≠ N88), G113 (= G111), G114 (≠ A112), G117 (≠ S115), A136 (≠ M134), W137 (≠ F135), I142 (≠ L140), N144 (≠ M142), D145 (= D143), E230 (= E228)
- binding 4-hydroxybenzoyl coenzyme a: R22 (≠ A23), H23 (≠ V24), R24 (≠ F25), A62 (≠ S63), F64 (≠ Q65), Y65 (≠ D66), L66 (= L67), R67 (≠ K68), W89 (≠ Y87), G113 (= G111), A136 (≠ M134), W137 (≠ F135), I142 (≠ L140), D145 (= D143), T146 (≠ A144), F252 (= F250), R257 (≠ K255)
- binding calcium ion: G49 (≠ R50), L202 (≠ Y200), A203 (≠ V201), A205 (= A203), T207 (≠ G205), Q210 (≠ I208)
3omeC Crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis (see paper)
33% identity, 75% coverage: 5:198/260 of query aligns to 5:194/247 of 3omeC
- active site: H65 (≠ Q65), E70 (≠ V70), A82 (≠ I83), L86 (≠ Y87), G110 (≠ A112), L113 (≠ S115), V133 (≠ F135), I138 (≠ L140), G139 (vs. gap), E142 (≠ M142)
- binding zinc ion: E81 (≠ I82), E142 (≠ M142)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
31% identity, 93% coverage: 19:260/260 of query aligns to 20:259/261 of 5jbxB
- active site: A67 (≠ Q65), R72 (≠ V70), L84 (≠ Y87), R88 (≠ I91), G112 (≠ A112), E115 (≠ S115), T134 (≠ M134), E135 (≠ F135), I140 (≠ L140), P142 (≠ M142), G143 (≠ D143), A228 (≠ E228), L238 (≠ G238)
- binding coenzyme a: S24 (≠ A23), R25 (≠ V24), R26 (≠ F25), A28 (= A27), A65 (≠ S63), D68 (= D66), L69 (= L67), K70 (= K68), L110 (≠ V110), G111 (= G111), T134 (≠ M134), E135 (≠ F135), L138 (≠ I138), R168 (≠ K168)
Query Sequence
>Echvi_0069 Echvi_0069 Enoyl-CoA hydratase/carnithine racemase
MDYKYIRSSVNNHCQEIAIDRPAVFNALNFEVLEELKAAFDQAAQAETVRCVVLTGGGGA
FCSGQDLKAVGTDLDGIPFKEIIRKYYNPLIIQMRNLSKPIICKLNGAAVGAGCSLALAT
DVIIASKEAYLAEMFAHIGLVMDAGSNYFLPKRVGYPLAFELATTGRKVYAEEAERLGLV
NKAIEHSALDETVAQYVEVYVNASGSAIGMIKEMLRKSNGMSLEEVLEMEAVYQEKAGSH
QDFKEGVTSFLEKRKPRFYK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory