SitesBLAST
Comparing Echvi_0072 FitnessBrowser__Cola:Echvi_0072 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A8M0 Asparagine--tRNA ligase; Asparaginyl-tRNA synthetase; AsnRS; EC 6.1.1.22 from Escherichia coli (strain K12) (see 3 papers)
55% identity, 96% coverage: 18:483/483 of query aligns to 16:466/466 of P0A8M0
- Y426 (≠ F443) mutation to F: No effect.; mutation to S: 15-fold increase in Km for ATP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1x55A Crystal structure of asparaginyl-tRNA synthetase from pyrococcus horikoshii complexed with asparaginyl-adenylate analogue (see paper)
34% identity, 96% coverage: 19:480/483 of query aligns to 16:431/434 of 1x55A
- active site: R211 (= R233), E213 (= E235), R219 (= R241), H220 (= H242), E357 (= E406), G360 (= G409), R408 (= R457)
- binding 5'-o-[n-(l-asparaginyl)sulfamoyl]adenosine: E168 (= E170), S188 (= S210), Q190 (= Q212), R211 (= R233), H220 (= H242), L221 (= L243), F224 (= F246), H226 (≠ M248), E228 (= E250), E357 (= E406), I358 (= I407), I359 (≠ V408), R364 (= R413), F402 (= F451), G403 (= G452), G405 (= G454), R408 (= R457)
1x54A Crystal structure of asparaginyl-tRNA synthetase from pyrococcus horikoshii complexed with asparaginyl-adenylate (see paper)
34% identity, 96% coverage: 19:480/483 of query aligns to 16:431/434 of 1x54A
- active site: R211 (= R233), E213 (= E235), R219 (= R241), H220 (= H242), E357 (= E406), G360 (= G409), R408 (= R457)
- binding 4-amino-1,4-dioxobutan-2-aminium adenosine-5'-monophosphate: E168 (= E170), S188 (= S210), Q190 (= Q212), R211 (= R233), H220 (= H242), L221 (= L243), F224 (= F246), H226 (≠ M248), E228 (= E250), E357 (= E406), I358 (= I407), I359 (≠ V408), R364 (= R413), F402 (= F451), G403 (= G452), G405 (= G454), R408 (= R457)
1b8aA Aspartyl-tRNA synthetase (see paper)
30% identity, 95% coverage: 19:476/483 of query aligns to 16:431/438 of 1b8aA
- binding adenosine-5'-triphosphate: R214 (= R233), E216 (= E235), H223 (= H242), L224 (= L243), E361 (= E406), I362 (= I407), S363 (≠ V408), S364 (≠ G409), G409 (= G454), R412 (= R457)
- binding manganese (ii) ion: E361 (= E406), S364 (≠ G409)
3nemB Aspartyl-tRNA synthetase complexed with aspartyl adenylate (see paper)
30% identity, 95% coverage: 19:476/483 of query aligns to 16:431/438 of 3nemB
- active site: R214 (= R233), E216 (= E235), R222 (= R241), H223 (= H242), E361 (= E406), S364 (≠ G409), R412 (= R457)
- binding adenosine-5'-triphosphate: R214 (= R233), E216 (= E235), H223 (= H242), L224 (= L243), E361 (= E406), I362 (= I407), S363 (≠ V408), S364 (≠ G409), G407 (= G452), G409 (= G454), R412 (= R457)
- binding magnesium ion: E361 (= E406), S364 (≠ G409)
3nemA Aspartyl-tRNA synthetase complexed with aspartyl adenylate (see paper)
30% identity, 95% coverage: 19:476/483 of query aligns to 16:431/438 of 3nemA
- active site: R214 (= R233), E216 (= E235), R222 (= R241), H223 (= H242), E361 (= E406), S364 (≠ G409), R412 (= R457)
- binding aspartyl-adenosine-5'-monophosphate: E170 (= E170), Q192 (= Q212), K195 (≠ G215), R214 (= R233), E216 (= E235), H223 (= H242), L224 (= L243), Y339 (= Y384), E361 (= E406), I362 (= I407), S363 (≠ V408), S364 (≠ G409), G365 (= G410), R368 (= R413), F406 (= F451), G407 (= G452), G409 (= G454), R412 (= R457)
3nelA Aspartyl-tRNA synthetase complexed with aspartic acid (see paper)
30% identity, 95% coverage: 19:476/483 of query aligns to 16:431/438 of 3nelA
- active site: R214 (= R233), E216 (= E235), R222 (= R241), H223 (= H242), E361 (= E406), S364 (≠ G409), R412 (= R457)
- binding aspartic acid: E170 (= E170), Q192 (= Q212), K195 (≠ G215), Y339 (= Y384), S364 (≠ G409), R368 (= R413), F406 (= F451), G407 (= G452)
Q52428 Aspartate--tRNA(Asp) ligase; Aspartyl-tRNA synthetase; AspRS; Discriminating aspartyl-tRNA synthetase; D-AspRS; EC 6.1.1.12 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
30% identity, 95% coverage: 19:476/483 of query aligns to 16:431/438 of Q52428
- W26 (≠ R29) mutation to H: Gains the ability to form Asp-tRNA(Asn) in vitro. Only 2-fold decrease in catalytic efficiency for Asp-tRNA(Asp) synthesis.
- K85 (≠ G87) mutation to P: Gains the ability to form Asp-tRNA(Asn) in vitro, and is impaired in its ability to synthesize Asp-tRNA(Asp) due to a 8-fold decrease in affinity for tRNA(Asp).
8h53A Human asparaginyl-tRNA synthetase in complex with asparagine-amp
26% identity, 95% coverage: 19:476/483 of query aligns to 14:420/427 of 8h53A
- binding imidodiphosphoric acid: R209 (= R241), H210 (= H242), E350 (= E406), R401 (= R457)
- binding 4-amino-1,4-dioxobutan-2-aminium adenosine-5'-monophosphate: E158 (= E170), S178 (= S210), Q180 (= Q212), R201 (= R233), L211 (= L243), Y214 (≠ F246), H216 (≠ M248), E218 (= E250), E350 (= E406), I351 (= I407), V352 (= V408), R357 (= R413), Y395 (≠ F451), G396 (= G452), G398 (= G454), R401 (= R457)
8tc9A Human asparaginyl-tRNA synthetase bound to osm-s-106 (see paper)
26% identity, 95% coverage: 19:476/483 of query aligns to 16:427/434 of 8tc9A
- binding N~1~-[(3M)-3-(4-aminothieno[3,2-d]pyrimidin-6-yl)benzene-1-sulfonyl]-L-aspartamide: E165 (= E170), S185 (= S210), Q187 (= Q212), R208 (= R233), H217 (= H242), L218 (= L243), Y221 (≠ F246), H223 (≠ M248), E225 (= E250), R364 (= R413), Y402 (≠ F451), G403 (= G452), R408 (= R457)
8tc8A Human asparaginyl-tRNA synthetase bound to adenosine 5'-sulfamate (see paper)
26% identity, 95% coverage: 19:476/483 of query aligns to 16:428/435 of 8tc8A
- binding 5'-o-[n-(l-asparaginyl)sulfamoyl]adenosine: E166 (= E170), S186 (= S210), Q188 (= Q212), R209 (= R233), E211 (= E235), H218 (= H242), L219 (= L243), Y222 (≠ F246), H224 (≠ M248), E226 (= E250), E358 (= E406), I359 (= I407), V360 (= V408), R365 (= R413), Y403 (≠ F451), G404 (= G452), G406 (= G454)
O07683 Aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS; EC 6.1.1.23 from Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium) (see paper)
29% identity, 96% coverage: 19:482/483 of query aligns to 16:435/436 of O07683
- H26 (≠ R29) mutation H->A,Q: Enhances enzyme specificity for tRNA(Asp) over tRNA(Asn), by decreasing the ability to form Asp-tRNA(Asn).
- P84 (≠ G87) mutation P->A,K: Enhances enzyme specificity for tRNA(Asp) over tRNA(Asn), by decreasing the ability to form Asp-tRNA(Asn).
2xgtB Asparaginyl-tRNA synthetase from brugia malayi complexed with the sulphamoyl analogue of asparaginyl-adenylate (see paper)
28% identity, 95% coverage: 22:481/483 of query aligns to 14:431/433 of 2xgtB
- binding 5'-o-[n-(l-asparaginyl)sulfamoyl]adenosine: E163 (= E170), S183 (= S210), Q185 (= Q212), R206 (= R233), E208 (= E235), H215 (= H242), L216 (= L243), Y219 (≠ F246), H221 (≠ M248), E223 (= E250), E356 (= E406), I357 (= I407), V358 (= V408), G359 (= G409), R363 (= R413), Y401 (≠ F451), G402 (= G452), G404 (= G454)
2xtiA Asparaginyl-tRNA synthetase from brugia malayi complexed with atp:mg and l-asp-beta-noh adenylate:ppi:mg (see paper)
28% identity, 95% coverage: 22:481/483 of query aligns to 16:431/433 of 2xtiA
- binding 5'-O-[(R)-{[(2S)-2-amino-4-(hydroxyamino)-4-oxobutanoyl]oxy}(hydroxy)phosphoryl]adenosine: E163 (= E170), S183 (= S210), Q185 (= Q212), R206 (= R233), E208 (= E235), H215 (= H242), L216 (= L243), Y219 (≠ F246), H221 (≠ M248), E223 (= E250), Y333 (= Y384), E356 (= E406), I357 (= I407), V358 (= V408), G359 (= G409), R363 (= R413), Y401 (≠ F451), G402 (= G452), G404 (= G454), R407 (= R457)
- binding pyrophosphate 2-: R214 (= R241), H215 (= H242), E356 (= E406), R407 (= R457)
3m4pA Entamoeba histolytica asparaginyl-tRNA synthetase (asnrs) in complex with asparaginyl-adenylate
27% identity, 95% coverage: 19:476/483 of query aligns to 15:428/435 of 3m4pA
- active site: R211 (= R233), E213 (= E235), R219 (= R241), H220 (= H242), E358 (= E406), G361 (= G409), R409 (= R457)
- binding 4-amino-1,4-dioxobutan-2-aminium adenosine-5'-monophosphate: S188 (= S210), Q190 (= Q212), R211 (= R233), H220 (= H242), L221 (= L243), Y224 (≠ F246), H226 (≠ M248), E358 (= E406), I359 (= I407), V360 (= V408), R365 (= R413), Y403 (≠ F451), G404 (= G452), G406 (= G454), R409 (= R457)
2xtiB Asparaginyl-tRNA synthetase from brugia malayi complexed with atp:mg and l-asp-beta-noh adenylate:ppi:mg (see paper)
29% identity, 95% coverage: 22:481/483 of query aligns to 15:427/429 of 2xtiB
- binding adenosine-5'-triphosphate: R202 (= R233), E204 (= E235), R210 (= R241), H211 (= H242), L212 (= L243), Y215 (≠ F246), E352 (= E406), I353 (= I407), V354 (= V408), G400 (= G454), R403 (= R457)
O74407 Aspartate--tRNA ligase, cytoplasmic; Aspartyl-tRNA synthetase; AspRS; EC 6.1.1.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 95% coverage: 19:478/483 of query aligns to 104:575/580 of O74407
- S282 (≠ T165) modified: Phosphoserine
- S307 (= S210) modified: Phosphoserine
P04802 Aspartate--tRNA ligase, cytoplasmic; Aspartyl-tRNA synthetase; AspRS; EC 6.1.1.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
29% identity, 73% coverage: 128:478/483 of query aligns to 239:552/557 of P04802
- P273 (= P162) mutation to G: Loss of activity; important for dimerization.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
1aszA The active site of yeast aspartyl-tRNA synthetase: structural and functional aspects of the aminoacylation reaction (see paper)
29% identity, 73% coverage: 128:478/483 of query aligns to 172:485/490 of 1aszA
- active site: R258 (= R233), E260 (= E235), R266 (= R241), H267 (= H242), E411 (= E406), S414 (≠ G409), R464 (= R457)
- binding adenosine-5'-triphosphate: R258 (= R233), M268 (≠ L243), F271 (= F246), E411 (= E406), I412 (= I407), L413 (≠ V408), G459 (= G452), R464 (= R457)
- binding : S213 (≠ A169), E214 (= E170), G215 (= G171), G216 (≠ A172), S217 (≠ G173), Q233 (≠ V209), F237 (≠ L213), E260 (= E235), N261 (= N236), S262 (= S237), N263 (= N238), H267 (= H242), S356 (≠ Q355), T357 (≠ S356), F388 (= F383)
Sites not aligning to the query:
- binding : 52, 53, 54, 57, 58, 60, 71, 73, 110, 112, 113, 135, 138, 140, 154, 156, 157, 158, 160, 163, 486
1asyA Class ii aminoacyl transfer RNA synthetases: crystal structure of yeast aspartyl-tRNA synthetase complexed with tRNA asp (see paper)
29% identity, 73% coverage: 128:478/483 of query aligns to 172:485/490 of 1asyA
- active site: R258 (= R233), E260 (= E235), R266 (= R241), H267 (= H242), E411 (= E406), S414 (≠ G409), R464 (= R457)
- binding : R258 (= R233), E260 (= E235), N261 (= N236), S262 (= S237), N263 (= N238), T264 (= T239), H267 (= H242), M268 (≠ L243), F271 (= F246), T357 (≠ S356), E411 (= E406), I412 (= I407), L413 (≠ V408), S414 (≠ G409), G459 (= G452), R464 (= R457)
Sites not aligning to the query:
- binding : 52, 53, 54, 58, 60, 71, 73, 88, 111, 112, 113, 114, 135, 138, 154, 156, 157, 158, 159, 162, 163, 486
Query Sequence
>Echvi_0072 FitnessBrowser__Cola:Echvi_0072
MAFNKRSKIKLLLESSKIGKNTTIMGWVRTKRGNKNVSFIAVNDGSTIQNYQVVADPNVI
SEEVLKRITTGACIKATGEVVASQGAGQDSELIAQKIEVLGEADADKYPLQPKKHSMEFL
RENAHLRMRTNTFGAVFRVRHALAFAVHQYFNDKGFFYIHTPIITASDAEGAGETFRVST
LDMKNPPLTEDGAVDYTKDFFERETNLTVSGQLEGELAAMALAEIYTFGPTFRAENSNTT
RHLAEFWMIEPEMAFYDAEDNQDLAEDFLKYIISYAMEHCKADLEFLDKRAAEENAKKPT
NERTELGLLDRLRFVVDHDFERISYTEAIEILKNSKPNKKKKFSYIIDEWGADLQSEHER
FLVEKHFKKPVILTDYPKDIKAFYMKQNDDGKTVAAMDILFPGIGEIVGGSQREENMEKL
TTRMDEMGISQEELYWYLDTRRFGATPHSGFGLGFERMVQFVTGMGNIRDVIAFPRTPGN
AEF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory