Comparing Echvi_0080 FitnessBrowser__Cola:Echvi_0080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
39% identity, 94% coverage: 17:354/358 of query aligns to 3:335/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
39% identity, 94% coverage: 17:354/358 of query aligns to 10:334/336 of 6nxcB
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
41% identity, 94% coverage: 20:355/358 of query aligns to 4:353/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
40% identity, 94% coverage: 20:357/358 of query aligns to 4:355/357 of 5dndD
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
37% identity, 94% coverage: 17:354/358 of query aligns to 1:323/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
35% identity, 94% coverage: 17:354/358 of query aligns to 1:300/301 of 7r6bB
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
33% identity, 94% coverage: 19:354/358 of query aligns to 92:427/437 of 1zq1A
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
33% identity, 79% coverage: 70:353/358 of query aligns to 50:324/326 of Q8TZE8
Sites not aligning to the query:
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
33% identity, 79% coverage: 70:353/358 of query aligns to 51:325/327 of 4q0mA
Sites not aligning to the query:
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
31% identity, 94% coverage: 20:354/358 of query aligns to 3:326/328 of 5ot0A
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
42% identity, 36% coverage: 70:199/358 of query aligns to 50:173/182 of 4njeA
Sites not aligning to the query:
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
42% identity, 36% coverage: 70:199/358 of query aligns to 50:173/175 of 5b5uA
Sites not aligning to the query:
5k45A Wolinella succinogenes l-asparaginase p121 + l-glutamic acid (see paper)
25% identity, 91% coverage: 17:343/358 of query aligns to 1:323/328 of 5k45A
5k3oA Wolinella succinogenes l-asparaginase p121 and l-aspartic acid (see paper)
25% identity, 91% coverage: 17:343/358 of query aligns to 1:323/328 of 5k3oA
8h4aB Blasnase-t13a/m57p
27% identity, 89% coverage: 17:334/358 of query aligns to 1:310/328 of 8h4aB
7c8qA Blasnase-t13a with d-asn (see paper)
27% identity, 89% coverage: 17:334/358 of query aligns to 1:310/321 of 7c8qA
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
25% identity, 77% coverage: 70:343/358 of query aligns to 36:301/306 of 7r5qA
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
25% identity, 77% coverage: 70:343/358 of query aligns to 56:321/326 of 1ho3A
Sites not aligning to the query:
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
25% identity, 77% coverage: 70:343/358 of query aligns to 78:343/348 of P00805
Sites not aligning to the query:
7c8xA Blasnase-t13a with l-asn (see paper)
27% identity, 89% coverage: 17:334/358 of query aligns to 1:309/319 of 7c8xA
>Echvi_0080 FitnessBrowser__Cola:Echvi_0080
MNYKIVRLNTAAKSEIKSSVLIIYTGGTLGMAYDESGALVPFNFGQIMEKIPNLGNLNIA
ITVISFPEPIDSSNVNMQHWVDMAYIIYENYDTYDGFVVLHGTDTMAYSASMLSFMLKGL
SKPVIFTGAQLPISAMRSDARENLMTSLEIAISQANGKPIVPEVCIFFNHMLLRGNRAKK
MQSVHFDAFESENYPPLAESGIVIDYNYAAIKPYKEGVQLKYLNKLDKRVMILKLFPGIT
AEVIDSCFSIKGLRGVVLETYGSGNSPTEPWFIETVRKAVDRGIIILNVSQCNGGRVIQG
RYETSKELKRLGVLSGGDITSEAAICKMMFLLANETDEDEIRRKLITPLAGEMSLTSK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory