SitesBLAST
Comparing Echvi_0089 FitnessBrowser__Cola:Echvi_0089 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3oa4A Crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125
41% identity, 96% coverage: 3:130/134 of query aligns to 4:131/138 of 3oa4A
Q96PE7 Methylmalonyl-CoA epimerase, mitochondrial; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 from Homo sapiens (Human) (see paper)
39% identity, 97% coverage: 1:130/134 of query aligns to 45:175/176 of Q96PE7
- H50 (= H6) binding
- R104 (≠ P60) to L: in dbSNP:rs6748672
- H122 (= H77) binding
- E172 (= E127) binding
6wfhA Streptomyces coelicolor methylmalonyl-coa epimerase substrate complex (see paper)
34% identity, 96% coverage: 1:128/134 of query aligns to 2:135/139 of 6wfhA
- active site: H7 (= H6), E43 (≠ T42), Q60 (≠ E53), H84 (= H77), E134 (= E127)
- binding cobalt (ii) ion: H7 (= H6), Q60 (≠ E53), H84 (= H77), E134 (= E127)
- binding (3S,5R,9R,19E)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,19-tetrahydroxy-8,8,20-trimethyl-10,14-dioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphahenicos-19-en-21-oic acid 3,5-dioxide (non-preferred name): H7 (= H6), Q39 (≠ E38), Q60 (≠ E53), A70 (≠ P63), K73 (= K66), W74 (≠ F67), H83 (= H76), H84 (= H77), L107 (= L100), G114 (= G107), S115 (≠ A108), F122 (= F115), P125 (= P118), K126 (≠ R119), L132 (= L125), E134 (= E127)
6wf6A Streptomyces coelicolor methylmalonyl-coa epimerase (see paper)
34% identity, 96% coverage: 1:128/134 of query aligns to 2:135/141 of 6wf6A
6xbqA Streptomyces coelicolor methylmalonyl-coa epimerase in complex with carboxy-carba(dethia)-coa
34% identity, 96% coverage: 1:128/134 of query aligns to 2:135/144 of 6xbqA
- active site: H7 (= H6), E43 (≠ T42), Q60 (≠ E53), H84 (= H77), E134 (= E127)
- binding carboxymethyldethia coenzyme *a: Q39 (≠ E38), Q60 (≠ E53), A70 (≠ P63), K73 (= K66), W74 (≠ F67), H83 (= H76), H84 (= H77), L107 (= L100), F122 (= F115), P125 (= P118), K126 (≠ R119), L132 (= L125)
- binding cobalt (ii) ion: H7 (= H6), Q60 (≠ E53), H84 (= H77), E134 (= E127)
6wfiA Methylmalonyl-coa epimerase in complex with 2-nitronate-propionyl-coa (see paper)
34% identity, 96% coverage: 1:128/134 of query aligns to 2:135/144 of 6wfiA
- active site: H7 (= H6), E43 (≠ T42), Q60 (≠ E53), H84 (= H77), E134 (= E127)
- binding cobalt (ii) ion: H7 (= H6), Q60 (≠ E53), H84 (= H77), E134 (= E127)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H6), Q39 (≠ E38), Q60 (≠ E53), A70 (≠ P63), K73 (= K66), W74 (≠ F67), H83 (= H76), H84 (= H77), L107 (= L100), G114 (= G107), S115 (≠ A108), I120 (≠ V113), F122 (= F115), P125 (= P118), L132 (= L125), E134 (= E127)
6wf7A Methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ (see paper)
34% identity, 96% coverage: 1:128/134 of query aligns to 2:135/144 of 6wf7A
- active site: H7 (= H6), E43 (≠ T42), Q60 (≠ E53), H84 (= H77), E134 (= E127)
- binding (S)-Methylmalonyl-Coenzyme A: Q39 (≠ E38), E43 (≠ T42), Q60 (≠ E53), A70 (≠ P63), W74 (≠ F67), H83 (= H76), H84 (= H77), L107 (= L100), G114 (= G107), S115 (≠ A108), F122 (= F115), P125 (= P118), K126 (≠ R119), L132 (= L125), E134 (= E127)
- binding methylmalonyl-coenzyme a: Q39 (≠ E38), Q60 (≠ E53), A70 (≠ P63), W74 (≠ F67), H83 (= H76), H84 (= H77), L107 (= L100), G114 (= G107), S115 (≠ A108), I120 (≠ V113), F122 (= F115), P125 (= P118), K126 (≠ R119), L132 (= L125), E134 (= E127)
6xbtA Streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa
34% identity, 96% coverage: 1:128/134 of query aligns to 2:135/140 of 6xbtA
- active site: H7 (= H6), E43 (≠ T42), A60 (≠ E53), H84 (= H77), E134 (= E127)
- binding cobalt (ii) ion: H7 (= H6), H84 (= H77), E134 (= E127)
- binding coenzyme a: Q39 (≠ E38), A70 (≠ P63), K73 (= K66), W74 (≠ F67), K77 (= K70), H83 (= H76), L107 (= L100), F122 (= F115), P125 (= P118), K126 (≠ R119), L132 (= L125)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H6), Q39 (≠ E38), A70 (≠ P63), K73 (= K66), W74 (≠ F67), H83 (= H76), H84 (= H77), L107 (= L100), G114 (= G107), S115 (≠ A108), P125 (= P118), K126 (≠ R119), L132 (= L125), E134 (= E127)
6qh4C Crystal structure of human methylmalonyl-coa epimerase (mcee) p.Arg143cys variant
39% identity, 97% coverage: 1:130/134 of query aligns to 9:137/138 of 6qh4C
2qh0A Crystal structure of a glyoxalase from clostridium acetobutylicum
30% identity, 96% coverage: 3:130/134 of query aligns to 3:128/129 of 2qh0A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
30% identity, 45% coverage: 42:101/134 of query aligns to 46:105/343 of 3zgjB
Sites not aligning to the query:
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
29% identity, 78% coverage: 1:104/134 of query aligns to 438:544/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
31% identity, 78% coverage: 1:104/134 of query aligns to 438:547/635 of Q88JU3
- H443 (= H6) binding
- H521 (= H77) binding
Sites not aligning to the query:
- 134 binding
- 165 binding
- 168 H→A: 21-fold decrease in turnover rate.
- 191 binding
- 206 S→A: 10-fold decrease in the affinity for dehydroshikimate without significantly altering the turnover rate.
- 239 binding
- 599 binding
Query Sequence
>Echvi_0089 FitnessBrowser__Cola:Echvi_0089
MRKIEHLGIAVKDLKKSNELFSRLFGKEAYKEERVEDEGVLTSFFQVGDVKIELLEATAP
DSPIAKFIDKRAEGVHHVAFAVDDIYAEMDRLKKAGFEILNDVPKKGADHKLVVFLHPRS
TNGVLVELCQDDVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory