Comparing Echvi_0124 FitnessBrowser__Cola:Echvi_0124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
37% identity, 98% coverage: 2:380/386 of query aligns to 3:384/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
37% identity, 98% coverage: 2:380/386 of query aligns to 3:384/392 of 6l1oB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
37% identity, 98% coverage: 2:380/386 of query aligns to 3:383/393 of 6l1nA
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
31% identity, 96% coverage: 14:384/386 of query aligns to 2:375/380 of 2x5dD
2o1bA Structure of aminotransferase from staphylococcus aureus
30% identity, 97% coverage: 5:380/386 of query aligns to 2:368/376 of 2o1bA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
27% identity, 97% coverage: 8:381/386 of query aligns to 2:379/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
27% identity, 97% coverage: 8:381/386 of query aligns to 2:379/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
28% identity, 93% coverage: 21:380/386 of query aligns to 23:391/402 of P14909
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 96% coverage: 10:380/386 of query aligns to 13:378/384 of 1o4sB
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
28% identity, 99% coverage: 5:386/386 of query aligns to 3:370/370 of Q58097
O84395 LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 from Chlamydia trachomatis (strain D/UW-3/Cx) (see paper)
29% identity, 93% coverage: 6:365/386 of query aligns to 6:371/394 of O84395
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
27% identity, 92% coverage: 26:379/386 of query aligns to 26:377/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
27% identity, 92% coverage: 26:379/386 of query aligns to 26:377/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
27% identity, 92% coverage: 26:379/386 of query aligns to 26:377/385 of Q56232
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
27% identity, 92% coverage: 26:379/386 of query aligns to 26:377/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
27% identity, 92% coverage: 26:379/386 of query aligns to 26:377/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
27% identity, 92% coverage: 26:379/386 of query aligns to 26:377/382 of 1gc3A
Sites not aligning to the query:
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
26% identity, 95% coverage: 13:379/386 of query aligns to 10:385/393 of 1xi9C
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 95% coverage: 17:381/386 of query aligns to 20:393/400 of Q02635
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
27% identity, 95% coverage: 17:381/386 of query aligns to 19:392/399 of 6f77A
>Echvi_0124 FitnessBrowser__Cola:Echvi_0124
MIAPAHRLANVKEYYFSKKLREVARLKAEGHPIINMGIGSPDLPPHPSVTEALNHSSAQP
TSHGYQSYQGIPALREAIASFYQKHYAVSLSPTDEILPMMGSKEAIMHISLAYLNPGDKV
LIPNPGYPTYSSVTELVGAKAVYYDLKEENQWLPDIGQLEELAQSGIKLMWINYPHMPTG
ANASREALEALVTFAKKHQILLVNDNPYSFILTQSPISILSIDGAKDIALELNSLSKTFN
MPGWRVGMLCGQASYLQEVLKVKSNMDSGMFLGIQEGAIAALNLDQRWFDQMDAIYHKRR
EAVWKLAERVGAICERNSAGMFVWAKLATQTTPSALVDKLLYENHIFITPGDIFGSNGHG
YIRFSLCVPENLIQEAFDRVNSTWTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory