Comparing Echvi_0125 FitnessBrowser__Cola:Echvi_0125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
31% identity, 96% coverage: 1:272/282 of query aligns to 5:279/286 of 3ggpA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
31% identity, 96% coverage: 1:272/282 of query aligns to 13:287/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
31% identity, 96% coverage: 1:272/282 of query aligns to 5:279/285 of 3ggoA
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
32% identity, 90% coverage: 1:253/282 of query aligns to 4:261/293 of 4wjiA
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
25% identity, 96% coverage: 2:273/282 of query aligns to 10:285/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
25% identity, 96% coverage: 2:273/282 of query aligns to 2:277/365 of 6u60B
Sites not aligning to the query:
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
26% identity, 96% coverage: 3:272/282 of query aligns to 2:271/279 of 2f1kA
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
27% identity, 95% coverage: 2:269/282 of query aligns to 7:286/286 of 3b1fA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
23% identity, 95% coverage: 8:276/282 of query aligns to 17:278/280 of 2pv7B
Sites not aligning to the query:
>Echvi_0125 FitnessBrowser__Cola:Echvi_0125
MKQIHIIGLGLLGGSFSLGLKKALTGLSVSGFDLNKGHLQEALSLGIIDRVSETVPADTD
LVIVATPVDTISGIVSRLLDHIPPETLVVDFGSTKEHICSSVSGHAHRQNFLAAHPIAGT
EYAGPSAAFPDLLKGKIMILCETDKTGPDLCKKAYRAFEALEMQIRIMGPHEHDNQLAFV
SHLSHISSFMLGKTVLDKMEDDKHILNMAGSGFASTVRLAKSSPSMWTPIMKENKENILE
ALNGYIENLASFRDHLVNDQYEELSKNMKNANQIGQILNFKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory