Comparing Echvi_0145 FitnessBrowser__Cola:Echvi_0145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
65% identity, 99% coverage: 3:397/397 of query aligns to 5:399/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
65% identity, 99% coverage: 3:397/397 of query aligns to 5:399/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
65% identity, 99% coverage: 3:397/397 of query aligns to 5:399/399 of 7bxqA
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
64% identity, 98% coverage: 8:397/397 of query aligns to 7:396/396 of 3tqxA
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
61% identity, 100% coverage: 1:397/397 of query aligns to 5:397/398 of P0AB77
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
61% identity, 100% coverage: 1:397/397 of query aligns to 8:400/401 of 1fc4A
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
65% identity, 95% coverage: 20:397/397 of query aligns to 22:399/400 of 7v58B
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
56% identity, 99% coverage: 5:397/397 of query aligns to 27:418/419 of Q0P5L8
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
40% identity, 99% coverage: 5:397/397 of query aligns to 8:397/398 of 7poaA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
36% identity, 96% coverage: 11:393/397 of query aligns to 13:391/392 of 3a2bA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
37% identity, 91% coverage: 37:396/397 of query aligns to 280:636/653 of Q5W264
Sites not aligning to the query:
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
34% identity, 89% coverage: 42:394/397 of query aligns to 189:547/587 of P08680
Sites not aligning to the query:
5qrdB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1328968520
33% identity, 89% coverage: 42:394/397 of query aligns to 48:406/428 of 5qrdB
Sites not aligning to the query:
5qrbB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434868
33% identity, 89% coverage: 42:394/397 of query aligns to 48:406/428 of 5qrbB
Sites not aligning to the query:
>Echvi_0145 FitnessBrowser__Cola:Echvi_0145
MYESLKPKLEKELKEISDAGLYKSERIITSPQGAEISTSEGKQVLNFCANNYLGLSSHPK
VIEAAKNAIDTHGYGMSSVRFICGTQDIHKELERKISEFLGTEDTILYAAAFDANGGVFE
PILGPEDAIISDALNHASIIDGVRLCKAMRFRYKHNDMEDLETQLKEANAKGAKQKIIVT
DGAFSMDGTIAQMDKIVALAEQYDALVMSDECHSTGFIGKTGRGVHELKGVMGKMDIITG
TLGKALGGASGGFTSGRKEIIDILRQRSRPYLFSNTLAPAITGASIAVFDLLSETTELRD
KLEDNTTYFREKMTAAGFDIKPGVHPIVPIMLYDAVLSQQMAEKLLERGVYVIGFYYPVV
PKGQARIRVQISAAHDRKHLDAAIEAFTEVGKELGVI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory