SitesBLAST
Comparing Echvi_0150 Echvi_0150 glutamate-1-semialdehyde-2,1-aminomutase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bs8A Crystal structure of glutamate 1-semialdehyde aminotransferase complexed with pyridoxamine-5'-phosphate from bacillus subtilis (see paper)
57% identity, 99% coverage: 4:428/429 of query aligns to 5:427/430 of 3bs8A
- active site: V22 (= V21), Y145 (= Y144), E207 (= E206), D240 (= D239), M243 (= M242), K268 (= K267), G401 (≠ S402)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G117), T119 (= T118), Y145 (= Y144), H146 (= H145), E207 (= E206), N212 (= N211), D240 (= D239), V242 (= V241), K268 (= K267)
6w80A Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from stenotrophomonas maltophilia k279a in complex with plp
56% identity, 98% coverage: 1:421/429 of query aligns to 6:418/430 of 6w80A
- active site: V26 (= V21), Y149 (= Y144), D241 (= D239), K269 (= K267)
- binding pyridoxal-5'-phosphate: S121 (= S116), G122 (= G117), T123 (= T118), Y149 (= Y144), H150 (= H145), E208 (= E206), N213 (= N211), D241 (= D239), V243 (= V241), K269 (= K267)
P23893 Glutamate-1-semialdehyde 2,1-aminomutase; GSA; Glutamate-1-semialdehyde aminotransferase; GSA-AT; EC 5.4.3.8 from Escherichia coli (strain K12) (see paper)
56% identity, 97% coverage: 3:420/429 of query aligns to 1:418/426 of P23893
- K265 (= K267) mutation to R: 2% of wild-type activity.
5i92F Crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa
56% identity, 99% coverage: 3:425/429 of query aligns to 1:418/420 of 5i92F
Sites not aligning to the query:
Q42522 Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic; GSA 2; Glutamate-1-semialdehyde aminotransferase 2; GSA-AT 2; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
54% identity, 100% coverage: 1:428/429 of query aligns to 46:472/472 of Q42522
- R92 (≠ F47) mutation to K: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with S-162.
- G162 (= G117) mutation to S: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with K-92.
2gsaB Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 2gsaB
- active site: V21 (= V21), Y144 (= Y144), E206 (= E206), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding pyridoxal-5'-phosphate: G117 (= G117), T118 (= T118), Y144 (= Y144), E206 (= E206), N211 (= N211), D239 (= D239), V241 (= V241), M242 (= M242), K267 (= K267)
2gsaA Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 2gsaA
- active site: V21 (= V21), Y144 (= Y144), E206 (= E206), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G117), T118 (= T118), Y144 (= Y144), H145 (= H145), G146 (= G146), N211 (= N211), D239 (= D239), V241 (= V241), K267 (= K267)
3usfA Crystal structure of dava-4
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 3usfA
- active site: V21 (= V21), Y144 (= Y144), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S23), V25 (= V25), S157 (= S157), K267 (= K267), E400 (= E401)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G117), T118 (= T118), Y144 (= Y144), N211 (= N211), D239 (= D239), V241 (= V241), K267 (= K267)
3fq7A Gabaculine complex of gsam (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 3fq7A
- active site: V21 (= V21), Y144 (= Y144), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: S23 (= S23), V25 (= V25), W61 (= W61), G117 (= G117), T118 (= T118), Y144 (= Y144), H145 (= H145), E206 (= E206), N211 (= N211), D239 (= D239), V241 (= V241), M242 (= M242), K267 (= K267), G298 (= G298), T299 (= T299), E400 (= E401)
2hp2A Inter-subunit signaling in gsam (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 2hp2A
- active site: V21 (= V21), Y144 (= Y144), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding (4s)-4,5-diaminopentanoic acid: G298 (= G298), T299 (= T299)
- binding (4r)-5-amino-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S23), G117 (= G117), T118 (= T118), Y144 (= Y144), H145 (= H145), E206 (= E206), N211 (= N211), D239 (= D239), V241 (= V241), M242 (= M242), K267 (= K267)
- binding pyridoxal-5'-phosphate: G298 (= G298), T299 (= T299)
2hp1A Inter-subunit signaling in gsam (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 2hp1A
- active site: V21 (= V21), Y144 (= Y144), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S23), V25 (= V25), W61 (= W61), S116 (= S116), G117 (= G117), T118 (= T118), Y144 (= Y144), H145 (= H145), G146 (= G146), E206 (= E206), N211 (= N211), D239 (= D239), V241 (= V241), M242 (= M242), K267 (= K267), E400 (= E401)
2hozA Inter-subunit signaling in gsam (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 5:419/427 of 2hozA
- active site: V21 (= V21), Y144 (= Y144), D239 (= D239), M242 (= M242), K267 (= K267), A401 (≠ S402)
- binding (4s)-4,5-diaminopentanoic acid: E141 (= E141), G156 (= G156), S157 (= S157), P182 (= P182), N368 (≠ D369), E370 (= E371), K373 (= K374)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G117), T118 (= T118), Y144 (= Y144), H145 (= H145), G146 (= G146), E206 (= E206), N211 (= N211), D239 (= D239), G298 (= G298), T299 (= T299)
3fqaA Gabaculien complex of gabaculine resistant gsam version (see paper)
54% identity, 97% coverage: 5:420/429 of query aligns to 4:418/426 of 3fqaA
- active site: V20 (= V21), Y143 (= Y144), D238 (= D239), I241 (≠ M242), K266 (= K267), A400 (≠ S402)
- binding 3-aminobenzoic acid: S22 (= S23), R25 (= R26), W60 (= W61)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G116 (= G117), T117 (= T118), Y143 (= Y144), E205 (= E206), N210 (= N211), D238 (= D239), V240 (= V241), I241 (≠ M242)
P42799 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic; AtGSA1; GSA 1; Glutamate-1-semialdehyde aminotransferase 1; GSA-AT 1; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
52% identity, 100% coverage: 1:428/429 of query aligns to 48:474/474 of P42799
- K314 (= K267) modified: N6-(pyridoxal phosphate)lysine
2e7uA Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from thermus thermophilus hb8
52% identity, 98% coverage: 6:425/429 of query aligns to 6:424/424 of 2e7uA
- active site: V21 (= V21), Y144 (= Y144), E206 (= E206), D238 (= D239), M241 (= M242), K266 (= K267), A401 (≠ S402)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G117), T118 (= T118), Y144 (= Y144), H145 (= H145), N211 (= N211), D238 (= D239), V240 (= V241)
3k28A Crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate
55% identity, 95% coverage: 5:411/429 of query aligns to 6:405/423 of 3k28A
- active site: V22 (= V21), Y145 (= Y144), E202 (= E206), D235 (= D239), M238 (= M242), K263 (= K267), G396 (≠ S402)
- binding calcium ion: I103 (≠ C102), V106 (= V105), P107 (= P106), I109 (≠ V108)
- binding pyridoxal-5'-phosphate: G118 (= G117), T119 (= T118), Y145 (= Y144), H146 (= H145), G147 (= G146), E202 (= E206), D235 (= D239), V237 (= V241), M238 (= M242), K263 (= K267)
5hdmB Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
52% identity, 100% coverage: 1:428/429 of query aligns to 2:428/428 of 5hdmB
- active site: V22 (= V21), Y145 (= Y144), E207 (= E206), D240 (= D239), M243 (= M242), K268 (= K267), A402 (≠ S402)
- binding pyridoxal-5'-phosphate: G118 (= G117), T119 (= T118), Y145 (= Y144), E207 (= E206), N212 (= N211), D240 (= D239), V242 (= V241), M243 (= M242), K268 (= K267)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G117), T119 (= T118), Y145 (= Y144), E207 (= E206), N212 (= N211), D240 (= D239), V242 (= V241), M243 (= M242), K268 (= K267)
5hdmA Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
52% identity, 100% coverage: 1:428/429 of query aligns to 2:428/428 of 5hdmA
- active site: V22 (= V21), Y145 (= Y144), E207 (= E206), D240 (= D239), M243 (= M242), K268 (= K267), A402 (≠ S402)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G117), T119 (= T118), Y145 (= Y144), G147 (= G146), E207 (= E206), N212 (= N211), D240 (= D239), V242 (= V241), K268 (= K267)
3usfB Crystal structure of dava-4
50% identity, 97% coverage: 5:420/429 of query aligns to 5:394/402 of 3usfB
- active site: V21 (= V21), Y144 (= Y144), E181 (= E206), D214 (= D239), M217 (= M242), K242 (= K267), A376 (≠ S402)
- binding (4s)-4,5-diaminopentanoic acid: G273 (= G298), T274 (= T299)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G117), T118 (= T118), Y144 (= Y144), E181 (= E206), N186 (= N211), D214 (= D239), V216 (= V241), M217 (= M242), K242 (= K267)
2hp1B Inter-subunit signaling in gsam (see paper)
50% identity, 97% coverage: 5:420/429 of query aligns to 5:390/398 of 2hp1B
- active site: V21 (= V21), Y144 (= Y144), E177 (= E206), D210 (= D239), M213 (= M242), K238 (= K267), A372 (≠ S402)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: G269 (= G298), T270 (= T299)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S23), V25 (= V25), R26 (= R26), W61 (= W61), Y144 (= Y144)
- binding pyridoxal-5'-phosphate: S116 (= S116), G117 (= G117), T118 (= T118), Y144 (= Y144), E177 (= E206), N182 (= N211), D210 (= D239), V212 (= V241), M213 (= M242), K238 (= K267)
Query Sequence
>Echvi_0150 Echvi_0150 glutamate-1-semialdehyde-2,1-aminomutase
MNIQNSKTLFSNAQNFIPGGVNSPVRAFKAVGGDPLFIKKAEGAYLFDEDDNRYIELINS
WGPMILGHNHPEINEAIVKAVENGTSFGAPTAKEIDIAELICKMVPSVEKVRMVNSGTEA
TMSAVRLARGYTGRDKFLKFEGNYHGHGDSFLIAAGSGAMTMGAPNSPGVTKGTAKDTLL
APYNDLNAVKEVLEANRDEVAAIILEPVPGNMGLVLPNEGFLQGLRKLCDEEGIVLIFDE
VMTGFRLAQGGAQEVFGVTPDLTTMGKIIGGGMPVGAYGGKKEIMDFVSPVGPVYQAGTL
SGNPIAMAAGFAMLDHLYQHPEVYQQLDQAGSKLVAGVKSSVEKLGLEYTMTHLGSMYSL
FFTKEKVVDFETAKTSDTVLFGKYFQAMLKRGVYLPPSQFESLFLSTALTDEHIDQIIDA
NEASLREIL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory