SitesBLAST
Comparing Echvi_0155 FitnessBrowser__Cola:Echvi_0155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gvfB Structure of tagatose-1,6-bisphosphate aldolase (see paper)
41% identity, 89% coverage: 1:245/274 of query aligns to 3:243/275 of 1gvfB
- active site: D81 (= D79), H82 (= H80), H171 (= H173), H199 (= H201), N221 (= N223)
- binding phosphoglycolohydroxamic acid: D81 (= D79), H82 (= H80), H171 (= H173), G172 (= G174), H199 (= H201), G200 (= G202), S202 (= S204), N221 (= N223), V222 (≠ L224), A223 (= A225), T224 (= T226)
- binding zinc ion: H82 (= H80), H171 (= H173), H199 (= H201)
P0AB74 D-tagatose-1,6-bisphosphate aldolase subunit KbaY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Ketose 1,6-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 from Escherichia coli (strain K12) (see paper)
39% identity, 89% coverage: 1:245/274 of query aligns to 4:252/286 of P0AB74
- D82 (= D79) active site, Proton donor
- H83 (= H80) binding
- H180 (= H173) binding
- H208 (= H201) binding
8q59A Crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) (see paper)
45% identity, 81% coverage: 19:240/274 of query aligns to 22:239/280 of 8q59A
- binding (3~{S},4~{S})-2,3,4-tris(oxidanyl)-5-oxidanylidene-6-phosphonooxy-hexane-1-sulfonic acid: G50 (≠ T47), Q51 (≠ K48), K52 (≠ S49), D82 (= D79), H83 (= H80), H172 (= H173), G173 (= G174), H200 (= H201), G201 (= G202), S203 (= S204), N222 (= N223), D224 (≠ A225), T225 (= T226)
- binding zinc ion: H83 (= H80), H172 (= H173), H200 (= H201)
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
41% identity, 94% coverage: 11:267/274 of query aligns to 12:276/285 of P13243
- T212 (≠ S204) modified: Phosphothreonine
- T234 (= T226) modified: Phosphothreonine
8q5aA Crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) (see paper)
42% identity, 83% coverage: 19:245/274 of query aligns to 22:244/276 of 8q5aA
3gayA Structure of giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate (see paper)
35% identity, 97% coverage: 3:267/274 of query aligns to 5:294/319 of 3gayA
- binding 1,6-di-O-phosphono-D-tagatose: N23 (= N21), S49 (≠ T47), D82 (= D79), H174 (= H173), G175 (= G174), K178 (= K177), H206 (= H201), G207 (= G202), S209 (= S204), N249 (= N223), D251 (≠ A225), S252 (≠ T226), R255 (≠ K229)
- binding zinc ion: H83 (= H80), H174 (= H173), H206 (= H201)
A8B2U2 Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) (see 4 papers)
35% identity, 97% coverage: 3:267/274 of query aligns to 6:298/323 of A8B2U2
- S50 (≠ T47) binding
- D83 (= D79) active site, Proton donor; mutation to A: Severe loss of catalytic activity.
- H84 (= H80) binding
- H178 (= H173) binding ; binding
- G179 (= G174) binding
- K182 (= K177) binding
- H210 (= H201) binding
- G211 (= G202) binding
- S213 (= S204) binding
- N253 (= N223) binding
- D255 (≠ A225) binding ; mutation to A: 9.4-fold reduction in substrate affinity and 50-fold reduction in catalytic affinity. Has some activity towards tagatose-1,6-bisphosphate.
- S256 (≠ T226) binding
- R259 (≠ K229) binding ; mutation to A: 1.8-fold reduction in substrate affinity and 2.8-fold reduction in catalytic efficiency. 6-fold reduction in substrate affinity and 24-fold reduction in catalytic efficiency; when associated with A-278.
- D278 (= D247) mutation to A: 159-fold reduction in substrate affinity and 2770-fold reduction in catalytic efficiency. 6-fold reduction in substrate affinity and 24-fold reduction in catalytic efficiency; when associated with A-259.
- R280 (= R249) binding
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
43% identity, 84% coverage: 21:250/274 of query aligns to 24:259/285 of 3q94A
- active site: D85 (= D79), H86 (= H80), E145 (≠ G139), H181 (= H173), H209 (= H201), N231 (= N223)
- binding zinc ion: H86 (= H80), E114 (= E108), H163 (≠ T155), H181 (= H173), H209 (= H201), E235 (= E227), E239 (≠ I231)
3ohiA Structure of giardia fructose-1,6-biphosphate aldolase in complex with 3-hydroxy-2-pyridone (see paper)
35% identity, 97% coverage: 3:267/274 of query aligns to 5:294/319 of 3ohiA
- binding ({3-hydroxy-2-oxo-4-[2-(phosphonooxy)ethyl]pyridin-1(2H)-yl}methyl)phosphonic acid: S49 (≠ T47), D82 (= D79), H83 (= H80), H174 (= H173), G175 (= G174), K178 (= K177), G207 (= G202), S209 (= S204), N249 (= N223), D251 (≠ A225), S252 (≠ T226), R255 (≠ K229)
- binding zinc ion: H83 (= H80), H174 (= H173), H206 (= H201)
3gb6A Structure of giardia fructose-1,6-biphosphate aldolase d83a mutant in complex with fructose-1,6-bisphosphate (see paper)
35% identity, 97% coverage: 3:267/274 of query aligns to 5:293/318 of 3gb6A
- binding 1,6-di-O-phosphono-D-fructose: N23 (= N21), S49 (≠ T47), H173 (= H173), G174 (= G174), K177 (= K177), H205 (= H201), G206 (= G202), S208 (= S204), N248 (= N223), D250 (≠ A225), S251 (≠ T226), R254 (≠ K229)
5ucpA Class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with fbp and cleavage products (see paper)
35% identity, 93% coverage: 16:270/274 of query aligns to 18:286/292 of 5ucpA
- binding 1,6-di-O-phosphono-D-fructose: S49 (≠ T47), D82 (= D79), H83 (= H80), H165 (= H173), K169 (vs. gap), G196 (= G202), S198 (= S204), N238 (= N223), D240 (≠ A225), T241 (= T226), R244 (≠ K229)
- binding zinc ion: H83 (= H80), H83 (= H80), H83 (= H80), E134 (= E131), H165 (= H173), H165 (= H173), H165 (= H173), H195 (= H201), H195 (= H201)
3n9rA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)-phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
35% identity, 93% coverage: 16:270/274 of query aligns to 18:291/297 of 3n9rA
- active site: C69 (≠ L67), E70 (≠ K68), G136 (= G133), H170 (= H173), A216 (vs. gap), N243 (= N223)
- binding 2-[hydroxy(4-hydroxybutyl)amino]-2-oxoethyl dihydrogen phosphate: H83 (= H80), H170 (= H173), G171 (= G174), K174 (vs. gap), H200 (= H201), G201 (= G202), S203 (= S204), N243 (= N223), D245 (≠ A225), T246 (= T226)
- binding zinc ion: H83 (= H80), H170 (= H173), H200 (= H201)
3c56A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor (see paper)
35% identity, 93% coverage: 16:270/274 of query aligns to 18:291/297 of 3c56A
- active site: C69 (≠ L67), E70 (≠ K68), G136 (= G133), H170 (= H173), A216 (vs. gap), N243 (= N223)
- binding 3-{hydroxy[(phosphonooxy)acetyl]amino}propyl dihydrogen phosphate: N23 (= N21), S49 (≠ T47), D82 (= D79), H170 (= H173), K174 (vs. gap), G201 (= G202), S203 (= S204), N243 (= N223), D245 (≠ A225), T246 (= T226), R249 (≠ K229)
- binding zinc ion: H83 (= H80), H170 (= H173), H200 (= H201)
2isvB Structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
35% identity, 97% coverage: 3:267/274 of query aligns to 5:283/307 of 2isvB
- binding phosphoglycolohydroxamic acid: D82 (= D79), H168 (= H173), G169 (= G174), K172 (= K177), H195 (= H201), G196 (= G202), S198 (= S204), N238 (= N223), D240 (≠ A225), S241 (≠ T226)
- binding zinc ion: H83 (= H80), H168 (= H173), H195 (= H201)
5uckA Class ii fructose-1,6-bisphosphate aldolase of helicobacter pylori with cleavage products (see paper)
35% identity, 93% coverage: 16:270/274 of query aligns to 18:285/291 of 5uckA
- binding glyceraldehyde-3-phosphate: S49 (≠ T47), D82 (= D79), H83 (= H80), H164 (= H173), D239 (≠ A225), R243 (≠ K229)
- binding zinc ion: H83 (= H80), H83 (= H80), E134 (= E131), H164 (= H173), H194 (= H201), H194 (= H201)
3c52A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
35% identity, 93% coverage: 16:270/274 of query aligns to 18:290/296 of 3c52A
- active site: C69 (≠ L67), E70 (≠ K68), G136 (= G133), H169 (= H173), A215 (vs. gap), N242 (= N223)
- binding calcium ion: D104 (= D101), S106 (= S103), E134 (= E131)
- binding phosphoglycolohydroxamic acid: D82 (= D79), H83 (= H80), H169 (= H173), K173 (vs. gap), H199 (= H201), G200 (= G202), S202 (= S204), N242 (= N223), D244 (≠ A225), T245 (= T226)
- binding zinc ion: H83 (= H80), H169 (= H173), H199 (= H201)
3n9sA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate, a competitive inhibitor (see paper)
34% identity, 93% coverage: 16:270/274 of query aligns to 18:301/307 of 3n9sA
- active site: C69 (≠ L67), E70 (≠ K68), G136 (= G133), H180 (= H173), A226 (vs. gap), N253 (= N223)
- binding calcium ion: D104 (= D101), S106 (= S103), E134 (= E131)
- binding 4-{hydroxy[(phosphonooxy)acetyl]amino}butyl dihydrogen phosphate: N23 (= N21), S49 (≠ T47), D82 (= D79), H83 (= H80), H180 (= H173), G181 (= G174), K184 (vs. gap), H210 (= H201), G211 (= G202), S213 (= S204), N253 (= N223), D255 (≠ A225), T256 (= T226)
- binding zinc ion: H83 (= H80), H180 (= H173), H210 (= H201)
2isvA Structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
34% identity, 97% coverage: 3:267/274 of query aligns to 5:274/298 of 2isvA
5ud4A Class ii fructose-1,6-bisphosphate aldolase h180q variant of helicobacter pylori with tbp (see paper)
34% identity, 93% coverage: 16:270/274 of query aligns to 18:287/293 of 5ud4A
- binding 1,6-di-O-phosphono-D-tagatose: S49 (≠ T47), D82 (= D79), Q166 (≠ H173), G167 (= G174), K170 (vs. gap), G197 (= G202), S199 (= S204), N239 (= N223), D241 (≠ A225), T242 (= T226), R245 (≠ K229)
- binding zinc ion: H83 (= H80), H83 (= H80), E134 (= E131), H196 (= H201), H196 (= H201)
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
39% identity, 90% coverage: 21:267/274 of query aligns to 23:268/279 of 4to8A
Query Sequence
>Echvi_0155 FitnessBrowser__Cola:Echvi_0155
MKLKHKLQEFTAQKRGLLATNFYNLETLQGVLKAASAMDEPVILQLTKSSIDYMGLNTAV
AMGRAALKEYGVEGWIHLDHGGSVELAQACLDAGFDSVMIDGSELPFEENVKITQEVVRR
AHKYGANVEAELGYVAKLGQSHEHQGFTTAEEAKTFVEQTGVDALAISIGTAHGFYKQEP
KLQFDLLSEIAAATEATLVLHGSSGVPEEQLRKAISGGICKVNLATEIKNIFMKTLQQLL
LQNEEIDLRKVFPKATKEVTDLVSYKLDIMKNDK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory