SitesBLAST
Comparing Echvi_0157 FitnessBrowser__Cola:Echvi_0157 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
27% identity, 99% coverage: 1:304/307 of query aligns to 2:312/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (= N186), S224 (≠ T216), G226 (= G218), I243 (≠ V235), I246 (≠ E238), G253 (= G245), S254 (≠ C246), G255 (= G247), T258 (≠ L250), M280 (≠ A272), G283 (= G275), M284 (≠ A276)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
27% identity, 99% coverage: 1:304/307 of query aligns to 5:314/314 of 2jgvB
- active site: G255 (= G245), S256 (≠ C246), G257 (= G247), D258 (= D248)
- binding adenosine-5'-diphosphate: S226 (≠ T216), A229 (≠ K219), I248 (≠ E238), P253 (≠ T243), S256 (≠ C246), G257 (= G247), N282 (≠ A272), G285 (= G275), M286 (≠ A276)
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 99% coverage: 1:304/307 of query aligns to 9:318/318 of 2jg1A
- active site: G259 (= G245), S260 (≠ C246), G261 (= G247), D262 (= D248)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (= K38), N193 (= N186), S230 (≠ T216), G232 (= G218), G235 (= G221), I252 (≠ E238), V254 (= V240), G259 (= G245), S260 (≠ C246), G261 (= G247), D262 (= D248), T264 (≠ L250), N286 (≠ A272), G289 (= G275), M290 (≠ A276)
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 99% coverage: 1:304/307 of query aligns to 6:315/315 of 2jg1C
- active site: G256 (= G245), S257 (≠ C246), G258 (= G247), D259 (= D248)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (≠ T216), G229 (= G218), A230 (≠ K219), G232 (= G221), I246 (≠ V235), I249 (≠ E238), V251 (= V240), V255 (= V244), G256 (= G245), S257 (≠ C246), G258 (= G247), D259 (= D248), T261 (≠ L250), N283 (≠ A272), G286 (= G275), M287 (≠ A276)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D12), G42 (= G37), K43 (= K38), R93 (= R88), C95 (= C90), L108 (≠ M106), G140 (= G138), S141 (= S139), D259 (= D248)
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
23% identity, 96% coverage: 2:296/307 of query aligns to 14:313/339 of P9WID3
- K283 (≠ E266) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
26% identity, 94% coverage: 1:289/307 of query aligns to 2:309/320 of 2ajrA
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
23% identity, 92% coverage: 1:281/307 of query aligns to 2:278/298 of 3julA
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
22% identity, 99% coverage: 1:304/307 of query aligns to 2:308/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (= N186), S220 (≠ T216), G222 (= G218), A223 (≠ K219), G225 (= G221), V242 (≠ E238), G249 (= G245), A250 (≠ C246), G251 (= G247), D252 (= D248), S279 (≠ G275), V283 (≠ C279)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
25% identity, 85% coverage: 35:295/307 of query aligns to 37:303/309 of 3uqdB
- active site: G253 (= G245), A254 (≠ C246), G255 (= G247), D256 (= D248)
- binding adenosine-5'-diphosphate: K185 (vs. gap), N187 (= N186), S224 (≠ T216), G226 (= G218), P227 (≠ K219), G229 (= G221), S248 (≠ V240), M258 (≠ L250), V280 (≠ A272), G283 (= G275), S284 (≠ A276)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G39 (= G37), N43 (≠ H41), R90 (= R88), R105 (≠ T103), S139 (= S139), G253 (= G245)
Sites not aligning to the query:
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
25% identity, 85% coverage: 35:295/307 of query aligns to 37:303/309 of 3uqdA
- active site: G253 (= G245), A254 (≠ C246), G255 (= G247), D256 (= D248)
- binding adenosine-5'-triphosphate: K185 (vs. gap), S224 (≠ T216), G226 (= G218), P227 (≠ K219), G229 (= G221), T251 (= T243), G255 (= G247), M258 (≠ L250), V280 (≠ A272), G283 (= G275), S284 (≠ A276), T287 (≠ C279)
- binding 6-O-phosphono-beta-D-fructofuranose: G38 (= G36), G39 (= G37), N43 (≠ H41), R90 (= R88), S139 (= S139), D256 (= D248)
Sites not aligning to the query:
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
25% identity, 85% coverage: 35:295/307 of query aligns to 37:303/309 of 3n1cA
Sites not aligning to the query:
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 85% coverage: 35:295/307 of query aligns to 37:303/309 of P06999
- KPN 185:187 (≠ --N 186) binding in other chain
- NQK 187:189 (≠ NEH 186:188) binding in other chain
- E190 (= E189) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ TKGKEG 216:221) binding in other chain
- S248 (≠ V240) binding in other chain
- S250 (= S242) binding
- V252 (= V244) binding
- V280 (≠ A272) binding in other chain
- S284 (≠ A276) binding in other chain
- A286 (≠ N278) binding
- N289 (≠ R281) binding
- G291 (≠ D283) binding
- R293 (≠ G285) binding
Sites not aligning to the query:
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
26% identity, 83% coverage: 35:288/307 of query aligns to 37:299/304 of 3cqdA
- active site: G253 (= G245), A254 (≠ C246), G255 (= G247), D256 (= D248)
- binding adenosine-5'-triphosphate: K185 (vs. gap), N187 (= N186), N187 (= N186), K189 (≠ H188), S224 (≠ T216), G226 (= G218), P227 (≠ K219), G229 (= G221), S248 (≠ V240), T251 (= T243), A254 (≠ C246), G255 (= G247), M258 (≠ L250), V280 (≠ A272), G283 (= G275), S284 (≠ A276), T287 (vs. gap)
Sites not aligning to the query:
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
26% identity, 81% coverage: 35:284/307 of query aligns to 37:292/307 of 3uqeA
- active site: G253 (= G245), A254 (≠ C246), G255 (= G247), D256 (= D248)
- binding adenosine-5'-triphosphate: K185 (vs. gap), N187 (= N186), S224 (≠ T216), G226 (= G218), P227 (≠ K219), G229 (= G221), S248 (≠ V240), A254 (≠ C246), G255 (= G247), M258 (≠ L250), V280 (≠ A272), G283 (= G275), S284 (≠ A276), T287 (≠ C279)
- binding pyrophosphate 2-: N187 (= N186), K189 (≠ H188)
3b1rA Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with amp-mg-amp (see paper)
28% identity, 36% coverage: 168:276/307 of query aligns to 174:280/310 of 3b1rA
- active site: D246 (≠ S242), P247 (≠ T243), G249 (= G245), C250 (= C246)
- binding adenosine monophosphate: T219 (= T216), G221 (= G218), E222 (≠ K219), G224 (= G221), G249 (= G245), C250 (= C246), D252 (= D248), F254 (≠ L250), S276 (≠ A272), G279 (= G275)
Sites not aligning to the query:
3b1pA Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with adp-inosine (see paper)
28% identity, 36% coverage: 168:276/307 of query aligns to 174:280/319 of 3b1pA
- active site: G249 (= G245), C250 (= C246), G251 (= G247), D252 (= D248)
- binding adenosine-5'-diphosphate: T219 (= T216), G221 (= G218), E222 (≠ K219), G224 (= G221), C250 (= C246), G251 (= G247), S276 (≠ A272), G279 (= G275)
- binding inosine: D252 (= D248)
Sites not aligning to the query:
3b1nB Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with adp-mizoribine (see paper)
28% identity, 36% coverage: 168:276/307 of query aligns to 174:280/320 of 3b1nB
- active site: G249 (= G245), C250 (= C246), G251 (= G247), D252 (= D248)
- binding adenosine-5'-diphosphate: T219 (= T216), G221 (= G218), E222 (≠ K219), G224 (= G221), C250 (= C246), G251 (= G247), S276 (≠ A272), G279 (= G275)
- binding 5-hydroxy-1-(beta-D-ribofuranosyl)-1H-imidazole-4-carboxamide: D252 (= D248)
Sites not aligning to the query:
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
26% identity, 49% coverage: 123:271/307 of query aligns to 141:300/338 of 3uboA
- active site: G274 (= G245), A275 (≠ C246), G276 (= G247), D277 (= D248)
- binding adenosine: E155 (≠ S137), Y157 (≠ S139), G274 (= G245), D277 (= D248)
- binding adenosine-5'-diphosphate: N214 (= N186), T244 (= T216), S246 (≠ G218), E247 (≠ K219), G249 (= G221), L266 (= L237), A275 (≠ C246), G276 (= G247)
Sites not aligning to the query:
- active site: 124
- binding adenosine: 10, 12, 14, 34, 57, 58, 59, 62, 126, 128, 313
- binding adenosine-5'-diphosphate: 301, 304, 308
Query Sequence
>Echvi_0157 FitnessBrowser__Cola:Echvi_0157
MVLSVCPNPSIDTYAWLEDFQLGKANRISKQEEFPGGKGVHVAMALQEAGAPTVLMAAWA
GHPGEWIKAACKERGMATVGVDLKGMNRKCYTFLAEATAIRNTELMEPGPEMNGEDFDRF
VGVFKDNLRQSALTVMSGSWPKGAPKTAYRELIAAANGSGKKVILDCSGEQLTHALEEKI
FGIHLNEHEAKQYCGTSSVHEAFDKLHEKVELIALTKGKEGLFLSYQGTRLHANVTLEKV
ISTVGCGDCLTAGVALGVSRGYGVEEIARYGAAFGAANCLRPDLGMIYKADVERLLPQVN
INELTYG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory