SitesBLAST
Comparing Echvi_0181 FitnessBrowser__Cola:Echvi_0181 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 3:291/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 1:289/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G148), I148 (≠ M150), Y166 (= Y168), D167 (= D169), P168 (≠ K170), I169 (≠ Y171), I170 (≠ L172), H198 (= H198), T199 (≠ V199), L208 (≠ F208), R228 (= R228)
7dkmA Phgdh covalently linked to oridonin (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 5:293/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A72), A102 (≠ V100), G148 (= G146), R151 (≠ N149), I152 (≠ M150), Y170 (= Y168), D171 (= D169), P172 (≠ K170), I173 (≠ Y171), H202 (= H198), T203 (≠ V199), P204 (= P200), T209 (= T205), C230 (≠ T226), A231 (= A227), R232 (= R228), H279 (= H284), G281 (≠ A286)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ S12), K17 (≠ P15), I18 (≠ L16), E293 (= E298)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 3:291/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N96), A100 (≠ V100), R149 (≠ N149), I150 (≠ M150), Y168 (= Y168), D169 (= D169), P170 (≠ K170), I171 (≠ Y171), H200 (= H198), T201 (≠ V199), P202 (= P200), T207 (= T205), C228 (≠ T226), A229 (= A227), R230 (= R228), H277 (= H284), G279 (≠ A286)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 4:292/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ F145), G147 (= G146), L148 (≠ Y147), G149 (= G148), R150 (≠ N149), I151 (≠ M150), G152 (= G151), D170 (= D169), H201 (= H198), T202 (≠ V199), P203 (= P200)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 4:292/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 4:292/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 4:292/301 of 6rj5A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
30% identity, 95% coverage: 3:298/311 of query aligns to 5:293/305 of 6plfA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
30% identity, 95% coverage: 3:298/311 of query aligns to 9:297/533 of O43175
- T78 (≠ A72) binding
- R135 (= R129) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NM 149:150) binding
- D175 (= D169) binding
- T207 (≠ V199) binding
- CAR 234:236 (≠ TAR 226:228) binding
- D260 (= D252) binding
- V261 (= V253) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAG 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 95% coverage: 1:295/311 of query aligns to 1:289/304 of 1wwkA
- active site: S96 (≠ N96), R230 (= R228), D254 (= D252), E259 (= E257), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (= V100), G146 (= G146), F147 (≠ Y147), G148 (= G148), R149 (≠ N149), I150 (≠ M150), Y168 (= Y168), D169 (= D169), P170 (≠ K170), V201 (= V199), P202 (= P200), T207 (= T205), T228 (= T226), S229 (≠ A227), D254 (= D252), H278 (= H284), G280 (≠ A286)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
34% identity, 81% coverage: 57:309/311 of query aligns to 58:318/334 of 3kb6B
- active site: S97 (≠ N96), R231 (= R228), D255 (= D252), E260 (= E257), H294 (= H284)
- binding lactic acid: S72 (≠ G71), V73 (≠ A72), G74 (= G73), Y96 (≠ G95), R231 (= R228), H294 (= H284)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A72), Y96 (≠ G95), V101 (= V100), G150 (= G148), R151 (≠ N149), I152 (≠ M150), D171 (= D169), V172 (≠ K170), P203 (= P200), T229 (= T226), A230 (= A227), R231 (= R228), H294 (= H284), A296 (= A286), Y297 (≠ G287)
Sites not aligning to the query:
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
29% identity, 95% coverage: 3:298/311 of query aligns to 3:283/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ N149), Y160 (= Y168), D161 (= D169), P162 (≠ K170), I164 (≠ L172), L179 (≠ F185), T193 (≠ V199), P194 (= P200), S198 (≠ E204), L202 (≠ F208)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
32% identity, 94% coverage: 3:295/311 of query aligns to 5:289/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
32% identity, 94% coverage: 3:295/311 of query aligns to 4:288/526 of 3dc2A
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
31% identity, 88% coverage: 30:304/311 of query aligns to 34:308/334 of 5aovA
- active site: L100 (≠ N96), R241 (= R228), D265 (= D252), E270 (= E257), H288 (= H284)
- binding glyoxylic acid: M52 (≠ R48), L53 (≠ S49), L53 (≠ S49), Y74 (≠ A70), A75 (≠ G71), V76 (≠ A72), G77 (= G73), R241 (= R228), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A72), T104 (≠ V100), F158 (≠ Y147), G159 (= G148), R160 (≠ N149), I161 (≠ M150), S180 (≠ D169), R181 (≠ K170), A211 (≠ H198), V212 (= V199), P213 (= P200), T218 (= T205), I239 (≠ T226), A240 (= A227), R241 (= R228), H288 (= H284), G290 (≠ A286)
2eklA Structure of st1218 protein from sulfolobus tokodaii
30% identity, 98% coverage: 4:308/311 of query aligns to 8:306/312 of 2eklA
- active site: S100 (≠ N96), R232 (= R228), D256 (= D252), E261 (= E257), H282 (= H284)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ A72), S100 (≠ N96), G148 (= G146), G150 (= G148), R151 (≠ N149), I152 (≠ M150), Y170 (= Y168), D171 (= D169), I172 (≠ Y171), L173 (= L172), H202 (= H198), V203 (= V199), T204 (≠ P200), I212 (≠ F208), T230 (= T226), S231 (≠ A227), D256 (= D252), G284 (≠ A286)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 99% coverage: 1:307/311 of query aligns to 56:371/466 of P87228
- S87 (≠ T31) modified: Phosphoserine
- S258 (≠ T202) modified: Phosphoserine
6ttbA Crystal structure of NAD-dependent formate dehydrogenase from staphylococcus aureus in complex with NAD
32% identity, 86% coverage: 33:298/311 of query aligns to 46:306/331 of 6ttbA
- binding nicotinamide-adenine-dinucleotide: V87 (≠ A72), N111 (= N96), V115 (= V100), F162 (= F145), G165 (= G148), R166 (≠ N149), I167 (≠ M150), Y185 (= Y168), D186 (= D169), P187 (≠ K170), H214 (= H198), A215 (≠ V199), P216 (= P200), T221 (= T205), T242 (= T226), A243 (= A227), R244 (= R228), H292 (= H284), S294 (≠ A286), G295 (= G287)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
29% identity, 93% coverage: 18:306/311 of query aligns to 21:317/330 of 4cukA
- active site: S101 (≠ N96), R234 (= R228), D258 (= D252), E263 (= E257), H295 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (≠ G95), G153 (= G148), K154 (≠ N149), I155 (≠ M150), F173 (≠ Y168), D174 (= D169), P175 (≠ K170), H204 (= H198), C205 (≠ V199), P206 (= P200), N211 (≠ T205), T232 (= T226), Y260 (≠ L254), H295 (= H284), A297 (= A286)
Query Sequence
>Echvi_0181 FitnessBrowser__Cola:Echvi_0181
MNILIIDEMHSSIIPLLEEKGFKVNYSPKITREEIEAIIADYEGLIIRSKTPMDKPLLEK
AKKLKFIGRAGAGLDKIDLDFIQKQGIKLFHAPEGNRDAVGEHAVAMLLMLFNNLKKADS
EVRQGVWDREGNRGEELQGKTVGIFGYGNMGKAFARRLSGFGVKVVAYDKYLDKYSDEYA
AQVTFDQLQQQADVLSIHVPLTEETRNFFTEEVLAGFSKPFYLINTARGEVISMETLNAA
LEKGILKGALLDVLENEKLHTLNDVQKTAFEKLSVRDDVLFSPHIAGWTFQSYKKINEVL
VSKISEAFLVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory