SitesBLAST
Comparing Echvi_0220 FitnessBrowser__Cola:Echvi_0220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
55% identity, 99% coverage: 3:292/292 of query aligns to 4:293/303 of P16703
- N71 (= N70) binding
- S255 (= S254) binding
2bhtA Crystal structure of o-acetylserine sulfhydrylase b (see paper)
55% identity, 99% coverage: 3:292/292 of query aligns to 4:293/294 of 2bhtA
- active site: K41 (= K40), S69 (= S68), Q199 (= Q198), G203 (= G202), S255 (= S254), C280 (= C279)
- binding pyridoxal-5'-phosphate: K41 (= K40), N71 (= N70), M173 (= M172), G174 (= G173), T175 (= T174), T176 (= T175), T178 (= T177), G208 (= G207), S255 (= S254), C280 (= C279)
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
41% identity, 100% coverage: 1:291/292 of query aligns to 1:301/302 of 2efyA
- active site: K40 (= K40), S70 (= S68), E200 (≠ Q198), S204 (≠ G202), S263 (= S254)
- binding 5-oxohexanoic acid: T69 (= T67), G71 (= G69), T73 (= T71), Q141 (= Q139), G175 (= G173), G219 (≠ R210), M220 (≠ W211), P222 (= P213)
- binding pyridoxal-5'-phosphate: K40 (= K40), N72 (= N70), Y172 (≠ S170), G175 (= G173), T176 (= T174), G177 (≠ T175), T179 (= T177), G219 (≠ R210), S263 (= S254), P289 (≠ C279), D290 (= D280)
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
41% identity, 100% coverage: 1:291/292 of query aligns to 1:301/302 of 2ecqA
- active site: K40 (= K40), S70 (= S68), E200 (≠ Q198), S204 (≠ G202), S263 (= S254)
- binding (3s)-3-hydroxybutanoic acid: K40 (= K40), G71 (= G69), T73 (= T71), Q141 (= Q139), G219 (≠ R210)
- binding pyridoxal-5'-phosphate: K40 (= K40), N72 (= N70), Y172 (≠ S170), G173 (≠ A171), G175 (= G173), T176 (= T174), T179 (= T177), G219 (≠ R210), S263 (= S254), P289 (≠ C279)
2ecoA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate
41% identity, 100% coverage: 1:291/292 of query aligns to 1:301/302 of 2ecoA
- active site: K40 (= K40), S70 (= S68), E200 (≠ Q198), S204 (≠ G202), S263 (= S254)
- binding 4-methyl valeric acid: K40 (= K40), T69 (= T67), G71 (= G69), T73 (= T71), Q141 (= Q139), G175 (= G173), T176 (= T174), G219 (≠ R210)
- binding pyridoxal-5'-phosphate: K40 (= K40), N72 (= N70), Y172 (≠ S170), G175 (= G173), T176 (= T174), T179 (= T177), G219 (≠ R210), S263 (= S254), P289 (≠ C279), D290 (= D280)
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
41% identity, 98% coverage: 5:291/292 of query aligns to 10:306/310 of 5xoqA
- binding : T72 (= T67), S73 (= S68), G74 (= G69), T76 (= T71), M123 (≠ I118), Q144 (= Q139), R218 (vs. gap), H219 (vs. gap), Q222 (≠ R209), G223 (≠ R210), A226 (≠ P213)
5xemA Crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum in complex with l-lanthionine-plp schiff base
40% identity, 98% coverage: 3:288/292 of query aligns to 6:302/302 of 5xemA
- binding (2R)-2-azanyl-3-[(2R)-2-azanyl-3-oxidanyl-3-oxidanylidene-propyl]sulfanyl-propanoic acid: K42 (= K40), T69 (= T67), S70 (= S68), N72 (= N70), T73 (= T71), M120 (≠ I118), Q142 (= Q139), G176 (= G173), T177 (= T174), G220 (vs. gap), M221 (vs. gap), G222 (vs. gap), S224 (= S212)
- binding calcium ion: L300 (= L286), S301 (= S287), N302 (≠ S288)
- binding pyridoxal-5'-phosphate: K42 (= K40), N72 (= N70), T175 (≠ M172), G176 (= G173), T177 (= T174), G178 (≠ T175), S180 (≠ T177), G220 (vs. gap), S266 (= S254), T293 (≠ C279), D294 (= D280)
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
41% identity, 98% coverage: 5:291/292 of query aligns to 11:308/322 of P47998
- K46 (= K40) modified: N6-(pyridoxal phosphate)lysine; mutation to A: No cysteine synthase activity.
- T74 (= T67) mutation to A: Strong reduction of cysteine synthase activity.; mutation to S: Reduction of cysteine synthase activity.
- S75 (= S68) mutation S->A,N,T: Strong reduction of cysteine synthase activity.
- N77 (= N70) binding ; mutation to A: Reduction of cysteine synthase activity.; mutation to D: Strong reduction of cysteine synthase activity.
- T78 (= T71) mutation T->A,S: Reduction of cysteine synthase activity.
- Q147 (= Q139) mutation Q->A,E: Strong reduction of cysteine synthase activity.
- H157 (= H149) mutation H->Q,N: Slight reduction of cysteine synthase activity.
- G162 (= G154) mutation to E: In old3-1; displays a early leaf death phenotype. Abolishes cysteine synthase activity.
- GTGGT 181:185 (≠ GTTGT 173:177) binding
- T182 (= T174) mutation T->A,S: Slight reduction of cysteine synthase activity.
- T185 (= T177) mutation T->A,S: Strong reduction of cysteine synthase activity.
- K217 (vs. gap) mutation to A: Impaired interaction with SAT1.
- H221 (vs. gap) mutation to A: Impaired interaction with SAT1.
- K222 (vs. gap) mutation to A: Impaired interaction with SAT1.
- S269 (= S254) binding ; mutation to A: Strong reduction of cysteine synthase activity.; mutation to T: Reduction of cysteine synthase activity.
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
41% identity, 98% coverage: 5:291/292 of query aligns to 9:306/320 of 2isqA
- active site: K44 (= K40), S267 (= S254)
- binding pyridoxal-5'-phosphate: K44 (= K40), N75 (= N70), G177 (≠ A171), G179 (= G173), T180 (= T174), G181 (≠ T175), T183 (= T177), G223 (≠ R210), S267 (= S254), P294 (≠ C279)
- binding : T72 (= T67), S73 (= S68), G74 (= G69), T76 (= T71), G122 (≠ T117), M123 (≠ I118), K124 (≠ E119), G217 (vs. gap), P218 (vs. gap), H219 (vs. gap), Q222 (≠ R209), G223 (≠ R210)
4jblB Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with methionine (see paper)
40% identity, 99% coverage: 3:291/292 of query aligns to 16:318/335 of 4jblB
- active site: K57 (= K40), S279 (= S254)
- binding methionine: K57 (= K40), T84 (= T67), S85 (= S68), N87 (= N70), T88 (= T71), M135 (≠ I118), Q158 (= Q139), F159 (= F140), G191 (= G173), G235 (≠ R210), I236 (≠ W211), A238 (≠ P213)
3bm5B Crystal structure of o-acetyl-serine sulfhydrylase from entamoeba histolytica in complex with cysteine (see paper)
40% identity, 99% coverage: 3:291/292 of query aligns to 16:318/335 of 3bm5B
- active site: K57 (= K40), S279 (= S254)
- binding cysteine: K57 (= K40), T84 (= T67), S85 (= S68), T88 (= T71), G235 (≠ R210)
- binding pyridoxal-5'-phosphate: K57 (= K40), N87 (= N70), G191 (= G173), T192 (= T174), S193 (≠ T175), T195 (= T177), G235 (≠ R210), S279 (= S254), P306 (≠ C279)
4jbnA Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with serine acetyl transferase derived tetrapeptide, spsi (see paper)
40% identity, 99% coverage: 3:291/292 of query aligns to 16:318/336 of 4jbnA
4il5A Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with isoleucine (see paper)
40% identity, 99% coverage: 3:291/292 of query aligns to 16:318/336 of 4il5A
P0ABK5 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; S-carboxymethylcysteine synthase; Sulfate starvation-induced protein 5; SSI5; EC 2.5.1.47; EC 4.5.1.5 from Escherichia coli (strain K12) (see 5 papers)
43% identity, 99% coverage: 2:291/292 of query aligns to 3:312/323 of P0ABK5
- K42 (= K40) modified: N6-(pyridoxal phosphate)lysine; mutation to A: Still stimulates tRNase activity of CdiA-CT in vitro and in vivo.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3bm5A Crystal structure of o-acetyl-serine sulfhydrylase from entamoeba histolytica in complex with cysteine (see paper)
40% identity, 99% coverage: 3:291/292 of query aligns to 16:318/338 of 3bm5A
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
42% identity, 98% coverage: 5:291/292 of query aligns to 19:316/323 of 4aecA
- active site: K54 (= K40), S277 (= S254)
- binding pyridoxal-5'-phosphate: K54 (= K40), N85 (= N70), I188 (≠ M172), G189 (= G173), T190 (= T174), G191 (≠ T175), G192 (= G176), T193 (= T177), G233 (≠ R210), S277 (= S254), P304 (≠ C279)
5xenA Crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum in complex with l-serine-plp schiff base
39% identity, 97% coverage: 3:286/292 of query aligns to 6:300/300 of 5xenA
- binding pyridoxal-5'-phosphate: K42 (= K40), K42 (= K40), N72 (= N70), N72 (= N70), T175 (≠ M172), T175 (≠ M172), G176 (= G173), G176 (= G173), T177 (= T174), T177 (= T174), G178 (≠ T175), G178 (≠ T175), S180 (≠ T177), S180 (≠ T177), G220 (vs. gap), G220 (vs. gap), S266 (= S254), S266 (= S254), T293 (≠ C279), T293 (≠ C279), D294 (= D280), D294 (= D280)
- binding serine: K42 (= K40), T69 (= T67), S70 (= S68), N72 (= N70), T73 (= T71), Q142 (= Q139)
P47999 Cysteine synthase, chloroplastic/chromoplastic; At.OAS.7-4; Beta-substituted Ala synthase 2;1; ARAth-Bsas2;1; CSase B; AtCS-B; CS-B; O-acetylserine (thiol)-lyase; O-acetylserine sulfhydrylase; OAS-TL B; cpACS1; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 98% coverage: 5:291/292 of query aligns to 81:378/392 of P47999
Sites not aligning to the query:
- 61 modified: N-acetylalanine
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 99% coverage: 5:292/292 of query aligns to 9:306/310 of P9WP55
- K44 (= K40) modified: N6-(pyridoxal phosphate)lysine
- N74 (= N70) binding
- GTGGT 178:182 (≠ GTTGT 173:177) binding
- S266 (= S254) binding
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
40% identity, 99% coverage: 5:292/292 of query aligns to 9:306/306 of 2q3dA
- active site: K44 (= K40), S266 (= S254), P293 (≠ C279)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: K44 (= K40), T71 (= T67), S72 (= S68), N74 (= N70), T75 (= T71), Q144 (= Q139), V177 (≠ M172), G178 (= G173), T179 (= T174), G180 (≠ T175), T182 (= T177), G222 (≠ R210), I223 (≠ W211), S266 (= S254), P293 (≠ C279), D294 (= D280)
Query Sequence
>Echvi_0220 FitnessBrowser__Cola:Echvi_0220
MKLFELIGNTPLVELEHIPTNPNVKIYCKLEGQNPGGSVKDRAAYSMIKRAMDRGDLKQG
DRVVEATSGNTGIALAMIAKVLGVEMTLIMPDNSTRERVVSMEAYGAKVILTPAAKTIEY
SRTLAEEMAKNEGYYILNQFANPDNYQAHYEGTGPEIMRDTNGEITHFVSAMGTTGTIMG
VSRYLKEQKPAVQIVGTQPTDGSSIPGIRRWSPEFLPKIYDASRVDQIIDVSQEEATEMT
RRMAKEEGILAGMSSGGALHAAVKLAESLDSGVIVCITCDRGDRYLSSDLFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory