SitesBLAST
Comparing Echvi_0275 FitnessBrowser__Cola:Echvi_0275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P11154 Pyruvate carboxylase 1; Pyruvic carboxylase 1; PCB 1; EC 6.4.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 74% coverage: 41:162/164 of query aligns to 1041:1166/1178 of P11154
- K1135 (= K131) modified: N6-biotinyllysine
2ejfC Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 (see paper)
53% identity, 40% coverage: 99:164/164 of query aligns to 3:68/69 of 2ejfC
4qshC Crystal structure of l. Monocytogenes pyruvate carboxylase in complex with cyclic-di-amp (see paper)
35% identity, 62% coverage: 62:163/164 of query aligns to 982:1078/1081 of 4qshC
Sites not aligning to the query:
- active site: 650
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 662, 689, 693, 696
- binding manganese (ii) ion: 481, 679, 681
Q05920 Pyruvate carboxylase, mitochondrial; Pyruvic carboxylase; PCB; EC 6.4.1.1 from Mus musculus (Mouse) (see paper)
42% identity, 40% coverage: 99:163/164 of query aligns to 1112:1176/1178 of Q05920
Sites not aligning to the query:
- 35 modified: N6-acetyllysine
- 39 modified: N6-acetyllysine
- 79 modified: N6-acetyllysine; alternate; mutation K->Q,R: Reduced pyruvate carboxylase activity.
- 148 modified: N6-acetyllysine
- 152 modified: N6-acetyllysine; mutation K->Q,R: Reduced pyruvate carboxylase activity.
- 241 modified: N6-acetyllysine
- 434 modified: N6-acetyllysine
- 589 modified: N6-acetyllysine
- 717 modified: N6-acetyllysine
- 748 modified: N6-acetyllysine; K→Q: Reduced pyruvate carboxylase activity.
- 892 modified: N6-acetyllysine
- 969 modified: N6-acetyllysine
3bg5A Crystal structure of staphylococcus aureus pyruvate carboxylase (see paper)
42% identity, 41% coverage: 97:163/164 of query aligns to 1069:1135/1137 of 3bg5A
Sites not aligning to the query:
- active site: 117, 159, 189, 202, 228, 267, 269, 281, 283, 285, 289, 337, 533, 639, 703, 732, 734, 755, 761, 762, 801, 867, 869, 881, 883, 888
- binding adenosine-5'-triphosphate: 117, 157, 159, 196, 197, 202, 226, 229, 269, 271, 281, 283
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 463, 471, 472, 473, 579
- binding manganese (ii) ion: 533, 732, 734
- binding pyruvic acid: 603, 703
A0A0H3JRU9 Pyruvate carboxylase; EC 6.4.1.1 from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see 2 papers)
42% identity, 41% coverage: 97:163/164 of query aligns to 1078:1144/1150 of A0A0H3JRU9
Sites not aligning to the query:
- 21 R→A: Complete loss of catalytic activity.
- 119 binding
- 161 binding
- 211 binding
- 278 binding
- 411 K→A: Complete loss of catalytic activity.
- 541:545 binding
- 542 binding
- 580 A→T: Complete loss of catalytic activity.
- 614 R→A: Complete loss of catalytic activity.
- 621 Y→A: Complete loss of catalytic activity.
- 712 binding
- 741 binding
- 743 binding
- 838 Q→A: About 2.5-fold loss of catalytic activity.
- 876 T→A: Complete loss of catalytic activity.
- 879 S→A: About 2-fold loss of catalytic activity.
- 880 K→T: Complete loss of catalytic activity.
4hnvB Crystal structure of r54e mutant of s. Aureus pyruvate carboxylase (see paper)
42% identity, 41% coverage: 97:163/164 of query aligns to 965:1031/1033 of 4hnvB
Sites not aligning to the query:
- active site: 117, 139, 165, 204, 206, 218, 220, 222, 226, 274, 429, 535, 599, 628, 630, 651, 657, 658, 697, 763, 765, 777, 779, 784
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 362, 368, 369, 475, 477
- binding manganese (ii) ion: 429, 599, 628, 630
3hb9A Crystal structure of s. Aureus pyruvate carboxylase a610t mutant (see paper)
42% identity, 41% coverage: 97:163/164 of query aligns to 1065:1131/1133 of 3hb9A
Sites not aligning to the query:
- active site: 117, 159, 198, 224, 263, 265, 277, 279, 281, 285, 333, 529, 635, 699, 728, 730, 751, 757, 758, 797, 863, 865, 877, 879, 884
- binding adenosine-5'-diphosphate: 117, 157, 192, 193, 198, 222, 225, 267, 276, 277
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 459, 462, 467, 468, 575, 577
- binding manganese (ii) ion: 529, 728, 730
3bg5B Crystal structure of staphylococcus aureus pyruvate carboxylase (see paper)
42% identity, 41% coverage: 97:163/164 of query aligns to 1006:1072/1074 of 3bg5B
Sites not aligning to the query:
- active site: 117, 139, 165, 204, 206, 218, 220, 222, 226, 274, 470, 576, 640, 669, 671, 692, 698, 699, 738, 804, 806, 818, 820, 825
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 403, 408, 409, 410, 516, 518
- binding manganese (ii) ion: 470, 669, 671
- binding pyruvic acid: 473, 640, 804
7zz3A Cryo-em structure of "bc react" conformation of lactococcus lactis pyruvate carboxylase with acetyl-coa (see paper)
35% identity, 65% coverage: 57:163/164 of query aligns to 1031:1136/1138 of 7zz3A
Sites not aligning to the query:
- binding acetyl coenzyme *a: 22, 43, 44, 45, 46, 48, 363, 413, 414, 416, 418, 459, 461, 1016, 1017, 1018
- binding adenosine-5'-triphosphate: 117, 156, 158, 163, 164, 165, 168, 200, 202, 203, 208, 232, 235, 277, 287, 289, 443
- binding bicarbonate ion: 237, 291, 293, 295
- binding biotin: 84, 294, 342
- binding magnesium ion: 275, 287, 520, 523, 754
- binding manganese (ii) ion: 535, 704, 733, 735
- binding pyruvic acid: 534, 538, 605, 704, 868
5vyzA Crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp (see paper)
35% identity, 65% coverage: 57:163/164 of query aligns to 1037:1142/1144 of 5vyzA
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 719, 722, 752, 753, 756
- binding adenosine-5'-diphosphate: 123, 162, 164, 168, 170, 171, 174, 208, 209, 214, 238, 241, 283, 293, 449
- binding magnesium ion: 281, 293
- binding manganese (ii) ion: 541, 710, 739, 741
8hwlA Human pyruvate carboxylase
42% identity, 40% coverage: 99:163/164 of query aligns to 875:939/941 of 8hwlA
Sites not aligning to the query:
P11498 Pyruvate carboxylase, mitochondrial; Pyruvic carboxylase; PCB; EC 6.4.1.1 from Homo sapiens (Human) (see 6 papers)
42% identity, 40% coverage: 99:163/164 of query aligns to 1112:1176/1178 of P11498
- VAK 1131:1133 (≠ VEK 118:120) natural variant: Missing (in PC deficiency)
- K1144 (= K131) modified: N6-biotinyllysine
Sites not aligning to the query:
- 145 V → A: in PC deficiency; mild; strongly reduced pyruvate carboxylase activity; dbSNP:rs28940591
- 156 R → Q: in PC deficiency; dbSNP:rs119103241
- 270 R → W: in PC deficiency; dbSNP:rs1258494752
- 304 Y → C: in PC deficiency
- 451 R → C: in PC deficiency; mild; strongly reduced pyruvate carboxylase activity; dbSNP:rs113994143
- 572 binding
- 583 R → L: in PC deficiency; dbSNP:rs119103242
- 610 A → T: in PC deficiency; mild; dbSNP:rs28940589
- 631 R → Q: in PC deficiency; dbSNP:rs113994145
- 741 binding via carbamate group; modified: N6-carboxylysine
- 743 M → I: in PC deficiency; mild; dbSNP:rs28940590
- 771 binding
- 773 binding
- 1077 mutation F->A,E: Loss of tetramerization and enzyme activity, resulting in an inactive homodimer.
5vyzC Crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp (see paper)
35% identity, 65% coverage: 57:163/164 of query aligns to 976:1081/1083 of 5vyzC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 657, 661, 691, 695
- binding adenosine-5'-diphosphate: 147, 153, 177, 222, 232, 388
- binding magnesium ion: 220, 232
- binding manganese (ii) ion: 480, 649, 678, 680
3bg3A Crystal structure of human pyruvate carboxylase (missing the biotin carboxylase domain at the n-terminus) (see paper)
31% identity, 65% coverage: 57:163/164 of query aligns to 578:678/680 of 3bg3A
Sites not aligning to the query:
- active site: 79, 185, 248, 278, 280, 415
- binding manganese (ii) ion: 79, 248, 278, 280
- binding pyruvic acid: 78, 82, 149, 151, 415
7wtdC Cryo-em structure of human pyruvate carboxylase with acetyl-coa in the intermediate state 1 (see paper)
42% identity, 40% coverage: 99:163/164 of query aligns to 1080:1144/1146 of 7wtdC
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 162, 167, 168, 206, 236, 239, 292
- binding coenzyme a: 21, 22, 25, 45, 46, 47, 48, 49, 50, 366, 413, 416, 419, 462, 464, 465, 466, 1024, 1053
7wtbB Cryo-em structure of human pyruvate carboxylase with acetyl-coa (see paper)
42% identity, 40% coverage: 99:163/164 of query aligns to 1081:1145/1147 of 7wtbB
Sites not aligning to the query:
- binding acetyl coenzyme *a: 22, 26, 46, 47, 48, 49, 50, 367, 414, 418, 420, 422, 462, 463, 465, 1025
- binding phosphoaminophosphonic acid-adenylate ester: 163, 168, 169, 173, 207, 208, 211, 240
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 582, 839, 877, 880, 881
8pn8G Engineered glycolyl-coa carboxylase (l100n variant) with bound coa (see paper)
26% identity, 95% coverage: 10:164/164 of query aligns to 58:213/213 of 8pn8G
8sgxX Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
39% identity, 45% coverage: 91:164/164 of query aligns to 583:656/657 of 8sgxX
3n6rA Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
40% identity, 38% coverage: 102:164/164 of query aligns to 528:590/591 of 3n6rA
Sites not aligning to the query:
- active site: 115, 138, 164, 203, 205, 218, 220, 222, 226, 268, 464
Query Sequence
>Echvi_0275 FitnessBrowser__Cola:Echvi_0275
MYSVTVNEKNFSIEQDGGDFLINGTIMDWEINPIDNRHFQIIKGQKSYVVELVKLDAAKK
ELTLKINNKSAEVKIQDKFDLLLEKLGMNGQANAKLTSITAPMPGLILEINVQEGDTVEK
DQPMVILEAMKMENIIKSPGDGIVKKILVTTGESVEKKQILIQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory