SitesBLAST
Comparing Echvi_0301 FitnessBrowser__Cola:Echvi_0301 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
36% identity, 71% coverage: 24:206/257 of query aligns to 1:191/261 of 6zzsD
- active site: G18 (= G41), S143 (= S158), Y156 (= Y171)
- binding nicotinamide-adenine-dinucleotide: G14 (= G37), S17 (≠ K40), I19 (= I42), D38 (= D54), M39 (≠ V55), D64 (= D78), V65 (= V79), N91 (= N106), A92 (= A107), G93 (= G108), M141 (≠ V156), A142 (= A157), S143 (= S158), Y156 (= Y171), K160 (= K175), P186 (= P201), G187 (= G202), V189 (= V204), T191 (= T206)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ G110), S143 (= S158), N145 (≠ A160), K153 (≠ M168), Y156 (= Y171)
Sites not aligning to the query:
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
36% identity, 71% coverage: 25:206/257 of query aligns to 1:190/260 of 6zzqA
- active site: G17 (= G41), S142 (= S158), Y155 (= Y171)
- binding acetoacetic acid: Q94 (≠ G110), S142 (= S158), K152 (≠ M168), Y155 (= Y171)
- binding nicotinamide-adenine-dinucleotide: G13 (= G37), S16 (≠ K40), G17 (= G41), I18 (= I42), D37 (= D54), M38 (≠ V55), D63 (= D78), V64 (= V79), N90 (= N106), A91 (= A107), G92 (= G108), M140 (≠ V156), A141 (= A157), S142 (= S158), Y155 (= Y171), K159 (= K175), Y187 (≠ S203), V188 (= V204), T190 (= T206)
Sites not aligning to the query:
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
31% identity, 87% coverage: 31:254/257 of query aligns to 3:238/239 of 3p19A
- active site: S132 (= S158), Y145 (= Y171), K149 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G37), S11 (= S39), S12 (≠ K40), G13 (= G41), I14 (= I42), A33 (≠ G61), R34 (= R62), R35 (≠ T63), D53 (= D78), V54 (= V79), N80 (= N106), A81 (= A107), G82 (= G108), I130 (≠ V156), S132 (= S158), Y145 (= Y171), K149 (= K175), P175 (= P201), A177 (≠ S203), V178 (= V204), T180 (= T206), E181 (≠ H207), L182 (≠ F208)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
32% identity, 79% coverage: 28:230/257 of query aligns to 4:200/244 of 1nfqA
- active site: G17 (= G41), S139 (= S158), Y152 (= Y171), K156 (= K175)
- binding Androsterone: L91 (≠ G110), E141 (≠ A160), C149 (≠ M168), Y152 (= Y171), V193 (≠ I212), I197 (≠ V227), F198 (≠ A228)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ K40), G17 (= G41), M18 (≠ I42), D37 (vs. gap), L39 (≠ V57), L59 (≠ C77), D60 (= D78), V61 (= V79), N87 (= N106), A88 (= A107), I137 (≠ V156), S139 (= S158), Y152 (= Y171), K156 (= K175), P182 (= P201), V185 (= V204), T187 (= T206), P188 (≠ H207), M189 (≠ F208), T190 (≠ F209)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
32% identity, 79% coverage: 28:230/257 of query aligns to 4:200/244 of 1nffA
- active site: G17 (= G41), S139 (= S158), Y152 (= Y171), K156 (= K175)
- binding nicotinamide-adenine-dinucleotide: G13 (= G37), R16 (≠ K40), G17 (= G41), M18 (≠ I42), D37 (vs. gap), I38 (= I56), L39 (≠ V57), L59 (≠ C77), D60 (= D78), V61 (= V79), N87 (= N106), A88 (= A107), G89 (= G108), I90 (≠ Y109), I137 (≠ V156), S139 (= S158), Y152 (= Y171), K156 (= K175), P182 (= P201), V185 (= V204), T187 (= T206), P188 (≠ H207), M189 (≠ F208), T190 (≠ F209)
2ehdB Crystal structure analysis of oxidoreductase
31% identity, 84% coverage: 34:250/257 of query aligns to 8:212/213 of 2ehdB
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 79% coverage: 28:230/257 of query aligns to 5:201/260 of P9WGT1
- I6 (≠ A29) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ KGI 40:42) binding
- D38 (vs. gap) binding
- V47 (≠ R64) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 78:79) binding
- T69 (≠ D86) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N106) binding
- S140 (= S158) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y171) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K175) binding
- 183:191 (vs. 201:209, 44% identical) binding
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
31% identity, 76% coverage: 27:221/257 of query aligns to 1:206/260 of 5b4tA
- active site: G15 (= G41), N114 (= N130), S142 (= S158), Y155 (= Y171), K159 (= K175), I200 (≠ M215)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ G110), S142 (= S158), H144 (≠ A160), K152 (≠ M168), Y155 (= Y171), W187 (≠ S203), Q196 (≠ D211)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), T13 (≠ S39), G15 (= G41), I16 (= I42), F36 (≠ W60), D63 (= D78), L64 (≠ V79), N90 (= N106), G92 (= G108), L113 (≠ V129), I140 (≠ V156), Y155 (= Y171), K159 (= K175), P185 (= P201), G186 (= G202), W187 (≠ S203), V188 (= V204), T190 (= T206), L192 (≠ F208), V193 (≠ F209)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
31% identity, 76% coverage: 27:221/257 of query aligns to 1:206/260 of 3w8dA
- active site: G15 (= G41), N114 (= N130), S142 (= S158), Y155 (= Y171), K159 (= K175), I200 (≠ M215)
- binding methylmalonic acid: Q94 (≠ G110), S142 (= S158), H144 (≠ A160), K152 (≠ M168), Y155 (= Y171), W187 (≠ S203), Q196 (≠ D211)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), T13 (≠ S39), S14 (≠ K40), G15 (= G41), I16 (= I42), F36 (≠ W60), A62 (≠ C77), D63 (= D78), L64 (≠ V79), N90 (= N106), A91 (= A107), G92 (= G108), L113 (≠ V129), S142 (= S158), Y155 (= Y171), K159 (= K175), P185 (= P201), G186 (= G202), W187 (≠ S203), V188 (= V204), T190 (= T206), L192 (≠ F208), V193 (≠ F209)
Sites not aligning to the query:
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
31% identity, 76% coverage: 27:221/257 of query aligns to 1:206/260 of 3vdrA
- active site: G15 (= G41), N114 (= N130), S142 (= S158), Y155 (= Y171), K159 (= K175), I200 (≠ M215)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ G110), H144 (≠ A160), K152 (≠ M168), Y155 (= Y171), W187 (≠ S203), Q196 (≠ D211)
- binding acetoacetic acid: Q94 (≠ G110), H144 (≠ A160), K152 (≠ M168), Y155 (= Y171), W187 (≠ S203), Q196 (≠ D211)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), T13 (≠ S39), I16 (= I42), F36 (≠ W60), D63 (= D78), L64 (≠ V79), N90 (= N106), A91 (= A107), G92 (= G108), L113 (≠ V129), K159 (= K175), G186 (= G202), V188 (= V204), T190 (= T206), L192 (≠ F208), V193 (≠ F209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G37), T13 (≠ S39), I16 (= I42), F36 (≠ W60), D63 (= D78), L64 (≠ V79), N90 (= N106), A91 (= A107), G92 (= G108), L113 (≠ V129), S142 (= S158), Y155 (= Y171), K159 (= K175), G186 (= G202), V188 (= V204), T190 (= T206), L192 (≠ F208), V193 (≠ F209)
Sites not aligning to the query:
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
31% identity, 76% coverage: 27:221/257 of query aligns to 1:206/260 of 3vdqA
- active site: G15 (= G41), N114 (= N130), S142 (= S158), Y155 (= Y171), K159 (= K175), I200 (≠ M215)
- binding acetate ion: Q94 (≠ G110), H144 (≠ A160), K152 (≠ M168), W187 (≠ S203), L192 (≠ F208), Q196 (≠ D211)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), S14 (≠ K40), I16 (= I42), F36 (≠ W60), D63 (= D78), L64 (≠ V79), N90 (= N106), A91 (= A107), G92 (= G108), L113 (≠ V129), I140 (≠ V156), S142 (= S158), Y155 (= Y171), K159 (= K175), P185 (= P201), G186 (= G202), W187 (≠ S203), V188 (= V204), T190 (= T206), L192 (≠ F208), V193 (≠ F209)
1xg5C Structure of human putative dehydrogenase mgc4172 in complex with nadp
29% identity, 86% coverage: 31:250/257 of query aligns to 11:254/257 of 1xg5C
- active site: S150 (= S158), Y165 (= Y171), K169 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G37), S19 (= S39), G21 (= G41), I22 (= I42), A41 (≠ G61), R42 (= R62), T43 (= T63), D69 (= D78), L70 (≠ V79), N96 (= N106), G98 (= G108), I148 (≠ V156), S150 (= S158), Y165 (= Y171), K169 (= K175), G198 (= G202), V200 (= V204), T202 (= T206), F204 (= F208), K207 (vs. gap)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 78% coverage: 28:228/257 of query aligns to 5:217/244 of 4nbuB
- active site: G18 (= G41), N111 (= N130), S139 (= S158), Q149 (≠ M168), Y152 (= Y171), K156 (= K175)
- binding acetoacetyl-coenzyme a: D93 (≠ I112), K98 (≠ E117), S139 (= S158), N146 (≠ V165), V147 (≠ A166), Q149 (≠ M168), Y152 (= Y171), F184 (≠ S203), M189 (≠ F208), K200 (≠ G214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G37), N17 (≠ K40), G18 (= G41), I19 (= I42), D38 (≠ G59), F39 (≠ W60), V59 (≠ C77), D60 (= D78), V61 (= V79), N87 (= N106), A88 (= A107), G89 (= G108), I90 (≠ Y109), T137 (≠ V156), S139 (= S158), Y152 (= Y171), K156 (= K175), P182 (= P201), F184 (≠ S203), T185 (≠ V204), T187 (= T206), M189 (≠ F208)
2jahC Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus (see paper)
33% identity, 70% coverage: 28:208/257 of query aligns to 4:191/246 of 2jahC
- active site: S141 (= S158), Y154 (= Y171), K158 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G37), S15 (= S39), S16 (≠ K40), G17 (= G41), I18 (= I42), A37 (vs. gap), R38 (vs. gap), R39 (vs. gap), D63 (= D78), V64 (= V79), N90 (= N106), A91 (= A107), G92 (= G108), T113 (≠ V129), M139 (≠ V156), S141 (= S158), Y154 (= Y171), K158 (= K175), P184 (= P201), G185 (= G202), T186 (≠ S203), T187 (≠ V204), T189 (= T206), E190 (≠ H207), L191 (≠ F208)
Sites not aligning to the query:
2japA Clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta- lactamase inhibitor clavulanic acid (see paper)
33% identity, 70% coverage: 28:208/257 of query aligns to 3:190/245 of 2japA
- active site: S140 (= S158), Y153 (= Y171), K157 (= K175)
- binding (2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylic acid: M93 (≠ G110), S140 (= S158), A142 (= A160), Y153 (= Y171), T185 (≠ S203)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G37), S14 (= S39), S15 (≠ K40), G16 (= G41), I17 (= I42), A36 (vs. gap), R37 (vs. gap), R38 (vs. gap), L61 (≠ C77), D62 (= D78), V63 (= V79), N89 (= N106), A90 (= A107), G91 (= G108), T112 (≠ V129), M138 (≠ V156), S139 (≠ A157), S140 (= S158), Y153 (= Y171), K157 (= K175), P183 (= P201), T185 (≠ S203), T186 (≠ V204), T188 (= T206), E189 (≠ H207), L190 (≠ F208)
Sites not aligning to the query:
5b1yB Crystal structure of NADPH bound carbonyl reductase from aeropyrum pernix (see paper)
33% identity, 78% coverage: 33:232/257 of query aligns to 6:219/243 of 5b1yB
- active site: G14 (= G41), V20 (= V47), S141 (= S158), Y155 (= Y171), K159 (= K175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G37), R13 (≠ K40), I15 (= I42), Y34 (≠ G59), K35 (≠ W60), S36 (≠ G61), R37 (= R62), V61 (≠ C77), D62 (= D78), V63 (= V79), A90 (= A107), G91 (= G108), V139 (= V156), S141 (= S158), Y155 (= Y171), K159 (= K175), F187 (≠ S203), V188 (= V204), T190 (= T206)
3rkrA Crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with NADP (see paper)
31% identity, 87% coverage: 28:250/257 of query aligns to 3:218/221 of 3rkrA
- active site: G16 (= G41), S142 (= S158), Y155 (= Y171), K159 (= K175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G37), R15 (≠ K40), A36 (≠ G59), R37 (≠ W60), D38 (≠ G61), C61 (= C77), D62 (= D78), L63 (≠ V79), A90 (= A107), G91 (= G108), V92 (≠ Y109), G93 (= G110)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
31% identity, 70% coverage: 28:206/257 of query aligns to 2:186/255 of 2q2qD
- active site: G15 (= G41), S138 (= S158), Y151 (= Y171), K155 (= K175)
- binding nicotinamide-adenine-dinucleotide: G11 (= G37), T13 (≠ S39), S14 (≠ K40), G15 (= G41), I16 (= I42), F36 (≠ W60), D59 (= D78), L60 (≠ V79), N86 (= N106), G88 (= G108), L109 (≠ V129), I136 (≠ V156), S138 (= S158), Y151 (= Y171), K155 (= K175), P181 (= P201), G182 (= G202), W183 (≠ S203), V184 (= V204), T186 (= T206)
Sites not aligning to the query:
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
31% identity, 79% coverage: 28:229/257 of query aligns to 4:213/251 of 1zk4A
- active site: G17 (= G41), S142 (= S158), Y155 (= Y171), K159 (= K175)
- binding 1-phenylethanone: A93 (≠ G110), Y155 (= Y171), Y189 (≠ S203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G37), T15 (≠ S39), L16 (≠ K40), I18 (= I42), T36 (≠ W60), G37 (= G61), R38 (= R62), H61 (≠ C77), D62 (= D78), N89 (= N106), A90 (= A107), G91 (= G108), I92 (≠ Y109), Y155 (= Y171), G188 (= G202), I190 (≠ V204), T192 (= T206), L194 (≠ F208)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
28% identity, 77% coverage: 28:225/257 of query aligns to 5:198/255 of 2dtxA
Query Sequence
>Echvi_0301 FitnessBrowser__Cola:Echvi_0301
MKCFITPKKGTIWGDFAHNRINLFTMVLAGKTAIVTGVSKGIGLEVVRRLLDKDVIVAGW
GRTRPSLEHERFHFFSCDVSDPSSVDQAYEETGKALGHDIRILVNNAGYGKIGKIDEMSI
EDWKGMFDVNVHGIFYVTRKVVPNMKAQDEGHILNVASIAGQNGVANMAGYCGTKHAVKG
ISHALYMELREFGIKVSTIYPGSVRTHFFDDIEGMDAHENMMRPEDVAMTIVQTLETHPN
YFVAEVECRPLRPKGKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory