Comparing Echvi_0302 FitnessBrowser__Cola:Echvi_0302 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
37% identity, 94% coverage: 23:428/432 of query aligns to 1:388/389 of 4ewtA
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 90% coverage: 42:428/432 of query aligns to 52:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
35% identity, 90% coverage: 37:425/432 of query aligns to 9:373/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 95% coverage: 19:428/432 of query aligns to 31:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 88% coverage: 25:406/432 of query aligns to 6:374/398 of 6slfA
3ramA Crystal structure of hmra (see paper)
24% identity, 66% coverage: 39:324/432 of query aligns to 19:270/391 of 3ramA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
22% identity, 65% coverage: 35:314/432 of query aligns to 2:275/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
22% identity, 65% coverage: 35:314/432 of query aligns to 2:275/375 of 4pqaA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 69% coverage: 45:340/432 of query aligns to 16:294/373 of 3rzaA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
20% identity, 66% coverage: 31:314/432 of query aligns to 2:279/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
21% identity, 65% coverage: 34:314/432 of query aligns to 1:275/377 of P44514
Sites not aligning to the query:
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
26% identity, 47% coverage: 128:328/432 of query aligns to 101:289/400 of 7yh4A
Sites not aligning to the query:
>Echvi_0302 FitnessBrowser__Cola:Echvi_0302
MSKPYLLLICIFFGGSVWGQSSLHRKIDDQATSIEPKVIEWRRDIHQNPELGNQETRTAK
LIASHLRSLGLEVEEKVAVTGVVGLLKGDHPGPTVALRADMDALPVTERNDLPFKSTKKT
VYNGQEIGIMHACGHDTHVAILMGVAEVLSSMKNDLHGTVKFIFQPAEEGVFEEGISSWG
AKQMVEEGVMDGVDAVFGLHINSQTEVGDIKYRSGPAMAAVDNLKLTVNGRQAHGAYPWS
SVDPIVTSSQMISALQTIISRNVNITENPAIVTIGSIHGGVRQNIIPEKVEMLGTVRTYG
TAQQELIHQRIHDIATHTAEAAGATVDVDIDKIYPATINDPGLTEKMVNTLKTVAGEEHV
IYHDPITGAEDFSYFQQQVPGLFIFLGGMPKGADPTKVAAHHTPDFFIDESGLLLGVRAL
SYLTVDYMAMDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory