SitesBLAST
Comparing Echvi_0337 FitnessBrowser__Cola:Echvi_0337 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
54% identity, 98% coverage: 6:397/399 of query aligns to 4:391/394 of P40924
- S183 (≠ G187) modified: Phosphoserine
- T299 (= T303) modified: Phosphothreonine
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
51% identity, 98% coverage: 7:397/399 of query aligns to 4:393/398 of 1vpeA
- active site: R35 (= R39), K196 (= K201), G353 (= G357), G376 (= G380)
- binding phosphoaminophosphonic acid-adenylate ester: G194 (= G199), A195 (= A200), K196 (= K201), K200 (= K205), G218 (= G223), A219 (≠ G224), N316 (= N320), P318 (= P322), G320 (= G324), V321 (= V325), E323 (= E327), G352 (= G356), G353 (= G357), D354 (= D358), S355 (= S359)
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
51% identity, 98% coverage: 7:397/399 of query aligns to 5:394/654 of P36204
- R36 (= R39) binding
- R118 (= R121) binding
- R151 (= R154) binding
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
53% identity, 98% coverage: 6:398/399 of query aligns to 4:392/394 of 1phpA
- active site: R36 (= R39), K197 (= K201), G351 (= G357), G374 (= G380)
- binding adenosine-5'-diphosphate: G195 (= G199), K201 (= K205), G219 (= G223), G220 (= G224), L237 (= L241), N316 (= N320), P318 (= P322), G320 (= G324), V321 (= V325), E323 (= E327), G350 (= G356), D352 (= D358), S353 (= S359)
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
53% identity, 98% coverage: 6:398/399 of query aligns to 4:392/394 of P18912
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 98% coverage: 7:397/399 of query aligns to 8:411/414 of O60101
- Y75 (≠ F74) modified: Phosphotyrosine
- S76 (= S75) modified: Phosphoserine
- S143 (vs. gap) modified: Phosphoserine
- S172 (≠ A157) modified: Phosphoserine
- S173 (= S158) modified: Phosphoserine
- S183 (≠ C171) modified: Phosphoserine
- S253 (= S240) modified: Phosphoserine
- S260 (≠ M247) modified: Phosphoserine
- T299 (≠ K286) modified: Phosphothreonine
- S328 (= S314) modified: Phosphoserine
- S351 (≠ A337) modified: Phosphoserine
- T373 (≠ S359) modified: Phosphothreonine
- S387 (= S373) modified: Phosphoserine
- S390 (= S376) modified: Phosphoserine
Sites not aligning to the query:
- 412 modified: Phosphoserine
- 413 modified: Phosphoserine
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
48% identity, 98% coverage: 7:397/399 of query aligns to 8:414/417 of P09041
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
48% identity, 98% coverage: 7:397/399 of query aligns to 6:402/405 of 2wzcA
- active site: R37 (= R39), K204 (= K201), G362 (= G357), G385 (= G380)
- binding adenosine-5'-diphosphate: G202 (= G199), A203 (= A200), K204 (= K201), K208 (= K205), G226 (= G223), G227 (= G224), N325 (= N320), P327 (= P322), G329 (= G324), V330 (= V325), E332 (= E327), G361 (= G356), D363 (= D358), T364 (≠ S359)
- binding tetrafluoroaluminate ion: R37 (= R39), K204 (= K201), K208 (= K205), G361 (= G356), G362 (= G357), G384 (= G379)
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
48% identity, 98% coverage: 7:397/399 of query aligns to 6:402/405 of 2wzbA
- active site: R37 (= R39), K204 (= K201), G362 (= G357), G385 (= G380)
- binding adenosine-5'-diphosphate: G202 (= G199), A203 (= A200), K204 (= K201), K208 (= K205), G226 (= G223), G227 (= G224), N325 (= N320), P327 (= P322), G329 (= G324), V330 (= V325), E332 (= E327), G361 (= G356), D363 (= D358), T364 (≠ S359)
- binding trifluoromagnesate: K204 (= K201), K208 (= K205), G361 (= G356), G384 (= G379), G385 (= G380)
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
48% identity, 98% coverage: 7:397/399 of query aligns to 4:410/413 of 2paaA
- active site: R35 (= R39), K212 (= K201), G370 (= G357), G393 (= G380)
- binding adenosine-5'-triphosphate: G210 (= G199), A211 (= A200), K216 (= K205), G235 (= G224), L253 (= L241), G309 (= G296), L310 (= L297), G334 (= G321), G337 (= G324), V338 (= V325), E340 (= E327), D371 (= D358)
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
48% identity, 98% coverage: 7:397/399 of query aligns to 6:404/407 of 4axxA
- active site: R37 (= R39), K206 (= K201), G364 (= G357), G387 (= G380)
- binding adenosine-5'-diphosphate: G204 (= G199), A205 (= A200), K210 (= K205), G228 (= G223), G229 (= G224), N327 (= N320), P329 (= P322), G331 (= G324), V332 (= V325), E334 (= E327), G363 (= G356), G364 (= G357), D365 (= D358), T366 (≠ S359)
- binding beryllium trifluoride ion: K206 (= K201), K210 (= K205), G363 (= G356)
2x15A The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp and 1,3- bisphosphoglycerate
48% identity, 98% coverage: 7:397/399 of query aligns to 6:405/408 of 2x15A
- active site: R37 (= R39), K207 (= K201), G365 (= G357), G388 (= G380)
- binding adenosine-5'-diphosphate: G205 (= G199), A206 (= A200), K207 (= K201), K211 (= K205), G229 (= G223), G230 (= G224), N328 (= N320), P330 (= P322), G332 (= G324), V333 (= V325), E335 (= E327), G364 (= G356), G365 (= G357), D366 (= D358), T367 (≠ S359)
- binding adenosine-5'-triphosphate: G205 (= G199), A206 (= A200), K207 (= K201), K211 (= K205), G229 (= G223), G230 (= G224), N328 (= N320), G332 (= G324), V333 (= V325), E335 (= E327), G364 (= G356), G365 (= G357), D366 (= D358), T367 (≠ S359), G387 (= G379), G388 (= G380)
- binding 1,3-bisphosphoglyceric acid: D22 (= D23), N24 (= N25), R37 (= R39), H61 (= H62), R64 (= R65), R121 (= R121), R162 (= R154), K207 (= K201), K211 (= K205), G364 (= G356), G387 (= G379), G388 (= G380)
2wzdA The catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with adp, 3pg and aluminium trifluoride (see paper)
48% identity, 98% coverage: 7:397/399 of query aligns to 6:402/405 of 2wzdA
- active site: R37 (= R39), K204 (= K201), G362 (= G357), G385 (= G380)
- binding adenosine-5'-diphosphate: G202 (= G199), A203 (= A200), K204 (= K201), G226 (= G223), G227 (= G224), N325 (= N320), P327 (= P322), G329 (= G324), V330 (= V325), E332 (= E327), G361 (= G356), D363 (= D358), T364 (≠ S359)
- binding aluminum fluoride: R37 (= R39), K204 (= K201), G361 (= G356), G362 (= G357), G384 (= G379)
1kf0A Crystal structure of pig muscle phosphoglycerate kinase ternary complex with amp-pcp and 3pg (see paper)
47% identity, 98% coverage: 7:397/399 of query aligns to 7:413/416 of 1kf0A
P00558 Phosphoglycerate kinase 1; Cell migration-inducing gene 10 protein; Primer recognition protein 2; PRP 2; EC 2.7.2.3 from Homo sapiens (Human) (see 16 papers)
47% identity, 98% coverage: 7:397/399 of query aligns to 8:414/417 of P00558
- DFN 24:26 (= DFN 23:25) binding
- R39 (= R39) binding
- HLGR 63:66 (= HLGR 62:65) binding
- L88 (≠ A86) to P: in PGK1D; with congenital non-spherocytic anemia; variant Matsue; dbSNP:rs137852531
- K97 (≠ P95) modified: N6-(2-hydroxyisobutyryl)lysine; alternate
- R123 (= R121) binding
- K131 (= K128) modified: N6-malonyllysine; alternate
- G158 (= G141) to V: in PGK1D; with chronic hemolytic anemia; variant Shizuoka; dbSNP:rs137852532
- D164 (= D147) to V: in PGK1D; with chronic hemolytic anemia and intellectual disability; variant Amiens; dbSNP:rs137852538
- R171 (= R154) binding
- K191 (≠ L176) natural variant: Missing (in PGK1D; with chronic hemolytic anemia; variant Alabama)
- R206 (= R191) to P: in PGK1D; with chronic hemolytic anemia; variant Uppsala; dbSNP:rs137852529
- K216 (= K201) modified: N6-(2-hydroxyisobutyryl)lysine
- K220 (= K205) binding ; modified: N6-(2-hydroxyisobutyryl)lysine
- E252 (≠ S236) to A: in PGK1D; with chronic hemolytic anemia; variant Antwerp
- V266 (≠ T250) to M: in PGK1D; with chronic non-spherocytic hemolytic anemia; variant Tokyo; dbSNP:rs431905501
- D268 (≠ E252) to N: in Munchen; 21% of activity; dbSNP:rs137852528
- D285 (= D269) to V: in PGK1D; with chronic hemolytic anemia; variant Herlev; 50% of activity; dbSNP:rs137852535
- G313 (= G296) binding
- D315 (= D298) to N: in PGK1D; with rhabdomyolysis; variant Creteil
- C316 (≠ I299) to R: in PGK1D; with chronic hemolytic anemia; variant Michigan; dbSNP:rs137852533
- K323 (≠ I306) modified: N6-(2-hydroxyisobutyryl)lysine
- E344 (= E327) binding
- T352 (= T335) to N: in dbSNP:rs137852530
- GGDT 373:376 (≠ GGDS 356:359) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2y3iA The structure of the fully closed conformation of human pgk in complex with l-adp, 3pg and the tsa aluminium tetrafluoride (see paper)
47% identity, 98% coverage: 7:397/399 of query aligns to 6:412/414 of 2y3iA
- active site: R37 (= R39), K214 (= K201), G372 (= G357), G395 (= G380)
- binding tetrafluoroaluminate ion: K214 (= K201), G371 (= G356), G372 (= G357), G394 (= G379)
- binding l-adenosine-5'-diphosphate: G212 (= G199), A213 (= A200), F290 (= F276), N335 (= N320), G339 (= G324), V340 (= V325), E342 (= E327), G371 (= G356), G372 (= G357), D373 (= D358), T374 (≠ S359)
4o33A Crystal structure of human pgk1 3pg and terazosin(tzn) ternary complex (see paper)
47% identity, 98% coverage: 7:397/399 of query aligns to 8:414/417 of 4o33A
- active site: R39 (= R39), K216 (= K201), G374 (= G357), G397 (= G380)
- binding [4-(4-amino-6,7-dimethoxyquinazolin-2-yl)piperazin-1-yl][(2R)-tetrahydrofuran-2-yl]methanone: G238 (= G223), G239 (= G224), T255 (≠ D239), L257 (= L241), F292 (= F276), M312 (= M295), G313 (= G296), L314 (= L297), G341 (= G324), V342 (= V325)
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
46% identity, 98% coverage: 6:398/399 of query aligns to 3:413/415 of 16pkA
- active site: R35 (= R39), K215 (= K201), G372 (= G357), G395 (= G380)
- binding 1,1,5,5-tetrafluorophosphopentylphosphonic acid adenylate ester: G213 (= G199), A214 (= A200), K219 (= K205), A238 (≠ G224), Y241 (= Y227), L311 (= L297), P336 (= P322), G338 (= G324), V339 (= V325), E341 (= E327), G393 (= G378), G394 (= G379), G395 (= G380)
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
46% identity, 98% coverage: 6:398/399 of query aligns to 3:413/415 of 13pkA
- active site: R35 (= R39), K215 (= K201), G372 (= G357), G395 (= G380)
- binding adenosine-5'-diphosphate: G213 (= G199), A214 (= A200), K219 (= K205), L311 (= L297), P336 (= P322), G338 (= G324), V339 (= V325), E341 (= E327), G371 (= G356), D373 (= D358), S374 (= S359)
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
46% identity, 98% coverage: 6:398/399 of query aligns to 7:417/440 of P07378
Query Sequence
>Echvi_0337 FitnessBrowser__Cola:Echvi_0337
MNSRIKSVDNLSFEGKRALVRVDFNVPLNANFEVTDDTRIQAALPTINKILNDGGAVILM
SHLGRPKGGPDEKFSLKHILLDLEKALDRPVKFAPDCIGEEAVQVAAALKGGEVLLLENL
RFYDEETKGDAGFAKKLAAMGDIYVNDAFGTAHRAHASTAIVAENFNDKVCGYLMLSELE
NADKVLGNPVRPLTAIMGGAKISDKILIIEKLLDKVDNLIIGGGMSYTFAKAKGGSIGDS
LLEADKMDLTKELEAKAKANGVNLYLPVDNITSKEFANDAEQGKAKSGEIPDGWMGLDIG
EETRKIFADVIKNSKTILWNGPMGVFEMESFDKGTKAVAEAVVAATKEGAFSLIGGGDSA
AAVNKFGFGEEVSFVSTGGGALLEYMEGKELPGVKALEP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory