SitesBLAST
Comparing Echvi_0363 FitnessBrowser__Cola:Echvi_0363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
28% identity, 95% coverage: 19:369/370 of query aligns to 8:321/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (≠ Y316), C272 (= C318), E273 (≠ Q319), G275 (= G321), C277 (= C323), G278 (≠ T324), C280 (= C326), C308 (= C356)
- binding flavin mononucleotide: N44 (≠ F53), R55 (= R67), T56 (≠ S68), Y57 (= Y69), S58 (= S70), A72 (≠ T84), V73 (= V85), G79 (vs. gap), R80 (vs. gap), G82 (= G91), S83 (≠ V92), I121 (≠ S135), T124 (= T138), E223 (= E256), F225 (= F258)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
28% identity, 95% coverage: 19:369/370 of query aligns to 9:322/322 of P33164
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
25% identity, 94% coverage: 21:369/370 of query aligns to 441:753/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ Y316), C702 (= C318), E703 (≠ Q319), G705 (= G321), C707 (= C323), G708 (≠ T324), C710 (= C326), C740 (= C356)
- binding flavin mononucleotide: R487 (= R67), Q488 (≠ S68), Y489 (= Y69), S490 (= S70), Q506 (≠ K86), S511 (≠ I88), R512 (≠ A89), G514 (= G91), S515 (= S94), I553 (≠ S135), E651 (= E256), F653 (= F258)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
27% identity, 65% coverage: 22:262/370 of query aligns to 105:333/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ F53), R144 (= R67), Q145 (≠ S68), Y146 (= Y69), S147 (= S70), H161 (≠ T84), V162 (= V85), V165 (≠ I88), G168 (= G91), V169 (= V92), A170 (≠ V93), T171 (≠ S94), T214 (≠ S135), F329 (= F258), P331 (≠ T260), S333 (= S262)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
27% identity, 65% coverage: 22:262/370 of query aligns to 106:334/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
P08619 Nitrate reductase [NADPH]; NR; EC 1.7.1.3 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see paper)
31% identity, 45% coverage: 88:253/370 of query aligns to 806:979/982 of P08619
Sites not aligning to the query:
- 652 H→A: Little loss of enzyme activity.
- 675 H→A: Loss of enzyme activity.
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
25% identity, 59% coverage: 46:263/370 of query aligns to 42:249/250 of 1tvcA
- active site: Y63 (= Y69), S64 (= S70), L215 (= L229)
- binding dihydroflavine-adenine dinucleotide: F49 (= F53), R61 (= R67), S62 (= S68), Y63 (= Y69), S64 (= S70), L78 (≠ T84), I79 (≠ V85), R80 (≠ K86), L82 (≠ I88), F87 (≠ V93), G128 (= G136), N155 (≠ R163), E159 (≠ Q167), S186 (= S195), G187 (= G196), E242 (= E256), F244 (= F258), L245 (≠ Y259)
Sites not aligning to the query:
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
28% identity, 63% coverage: 27:258/370 of query aligns to 157:390/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ F53), R204 (= R67), Q205 (≠ S68), Y206 (= Y69), S207 (= S70), A220 (≠ T84), V221 (= V85), E224 (≠ I88), G227 (= G91), Q228 (≠ V92), V229 (= V93), S230 (= S94), V269 (≠ S135), T272 (= T138), E388 (= E256), F390 (= F258)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 63% coverage: 27:258/370 of query aligns to 157:390/396 of P24232
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
- 135 active site, Charge relay system
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
25% identity, 60% coverage: 22:243/370 of query aligns to 16:233/243 of 2eixA
- active site: H47 (≠ F53), Y63 (= Y69), T64 (≠ S70), C217 (= C230)
- binding flavin-adenine dinucleotide: R61 (= R67), P62 (≠ S68), Y63 (= Y69), T64 (≠ S70), I78 (≠ T84), Y82 (≠ I88), K84 (≠ G90), G85 (= G91), M87 (≠ V93), S88 (= S94), T126 (≠ S135), T129 (= T138), F195 (≠ R204), M221 (≠ G234), A225 (vs. gap)
5ylyB Crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase (see paper)
29% identity, 48% coverage: 61:237/370 of query aligns to 71:248/269 of 5ylyB
- binding flavin-adenine dinucleotide: V82 (≠ C72), V83 (≠ T73), Y86 (= Y76), F94 (≠ R87), G97 (= G90), G98 (= G91), K99 (≠ V92), F100 (≠ V93), S101 (= S94), T149 (≠ S135), T152 (= T138)
Sites not aligning to the query:
A0A286R227 Nitrate reductase [NADH]; NR; EC 1.7.1.1 from Ulva prolifera (Green seaweed) (Enteromorpha prolifera) (see paper)
29% identity, 48% coverage: 61:237/370 of query aligns to 665:842/863 of A0A286R227
- VVKIY 676:680 (≠ CTSPY 72:76) binding
- F688 (≠ R87) binding
- KFS 693:695 (≠ VVS 92:94) binding
- T746 (= T138) binding
- C835 (= C230) mutation to A: Loss of enzyme activity to 21% of that of the wild-type, but increased affinity for NADH.
Sites not aligning to the query:
- 640 H→A: Minimal effect in enzyme activity and a minor change in affinity for NADH.
- 659 R→A: Loss of enzyme activity to 13% of that of the wild-type and decreased affinity for NADH.
- 659:662 binding
- 662 T→A: Loss of enzyme activity to 18% of that of the wild-type and decreased affinity for NADH.
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
31% identity, 58% coverage: 46:258/370 of query aligns to 32:235/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ F53), R55 (= R67), Q56 (≠ S68), Y57 (= Y69), S58 (= S70), S71 (≠ T84), V72 (= V85), E75 (≠ I88), N81 (vs. gap), G83 (= G91), L84 (≠ V92), V85 (= V93), S86 (= S94), T127 (= T138), E233 (= E256), F235 (= F258)
5h57A Ferredoxin iii from maize root (see paper)
47% identity, 20% coverage: 289:362/370 of query aligns to 11:84/97 of 5h57A
Q9DCN2 NADH-cytochrome b5 reductase 3; B5R; Cytochrome b5 reductase; Diaphorase-1; EC 1.6.2.2 from Mus musculus (Mouse) (see paper)
29% identity, 59% coverage: 20:237/370 of query aligns to 45:281/301 of Q9DCN2
Sites not aligning to the query:
- 2 G→A: Decreased levels in mitochondrion and reduced activity of mitochondrial respiratory complex I.
3w2eA Crystal structure of oxidation intermediate (20 min) of nadh- cytochrome b5 reductase from pig liver (see paper)
28% identity, 59% coverage: 20:237/370 of query aligns to 15:251/271 of 3w2eA
- active site: H48 (≠ F53), Y64 (= Y69), T65 (≠ S70), C244 (= C230)
- binding flavin-adenine dinucleotide: R62 (= R67), P63 (≠ S68), Y64 (= Y69), T65 (≠ S70), V79 (vs. gap), Y83 (vs. gap), H88 (= H80), F91 (≠ R87), G94 (= G90), G95 (= G91), K96 (≠ V92), M97 (≠ V93), S98 (= S94), T152 (≠ S135), T155 (= T138)
- binding nicotinamide-adenine-dinucleotide: K81 (vs. gap), Y83 (vs. gap), G151 (= G134), T152 (≠ S135), G153 (= G136), N180 (= N162), Q181 (≠ R163), D210 (≠ S192), F222 (≠ R204), C244 (= C230), G245 (= G231), P246 (= P232), P248 (≠ G234), M249 (≠ L235)
Sites not aligning to the query:
5gv7A Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a (see paper)
28% identity, 59% coverage: 20:237/370 of query aligns to 16:252/272 of 5gv7A
- active site: H49 (≠ F53), Y65 (= Y69), T66 (≠ S70), C245 (= C230)
- binding flavin-adenine dinucleotide: R63 (= R67), P64 (≠ S68), Y65 (= Y69), T66 (≠ S70), V80 (vs. gap), Y84 (vs. gap), H89 (= H80), F92 (≠ R87), G95 (= G90), G96 (= G91), K97 (≠ V92), M98 (≠ V93), S99 (= S94), T153 (≠ S135), T156 (= T138), P157 (= P139)
P83686 NADH-cytochrome b5 reductase 3; B5R; Cytochrome b5 reductase; Diaphorase-1; EC 1.6.2.2 from Sus scrofa (Pig) (see 4 papers)
28% identity, 59% coverage: 20:237/370 of query aligns to 16:252/272 of P83686
- H49 (≠ F53) mutation to A: Similar properties to wild-type.; mutation to E: Increase and decrease in Km values for Fe(II)-[cytochrome b5 and NADH respectively.; mutation to K: Decrease and increase in Km values for Fe(II)-[cytochrome b5 and NADH respectively.; mutation to Y: Similar properties to wild-type.
- R63 (= R67) binding ; mutation R->A,Q: Increased Km values for NADH and increased dissociation constant for NAD(+).; mutation to K: Km values for NADH and Fe(II)-[cytochrome b5 similar to that of wild-type.
- P64 (≠ S68) binding
- Y65 (= Y69) binding ; mutation Y->A,F: Protein destabilized, release of FAD accelerated, and kcat values decreased.
- T66 (≠ S70) mutation to A: Similar properties to wild-type.; mutation to S: Similar properties to wild-type.; mutation to V: 10% of wild-type kcat values.
- K97 (≠ V92) binding ; mutation to A: Little effect on absorption or CD spectra.; mutation to R: Little effect on absorption or CD spectra.
- M98 (≠ V93) binding
- S99 (= S94) binding ; mutation S->A,V: Increased Km values for NADH and increased dissociation constant for NAD(+).; mutation to T: Km values for NADH and Fe(II)-[cytochrome b5 similar to that of wild-type.
Sites not aligning to the query:
- 272 F→FG: 10% of wild-type kcat values.; mutation Missing: 54% of wild-type kcat values.
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
45% identity, 20% coverage: 289:362/370 of query aligns to 13:86/99 of P0A3C7
- R43 (≠ Q319) mutation R->A,E,H: No effect on electron transfer.
- T49 (≠ A325) mutation to A: No effect on electron transfer.
- F66 (≠ G342) mutation F->A,I: 1000-fold decrease in electron transfer.
- D69 (= D345) mutation to K: Small effect on electron transfer.
- D70 (≠ G346) mutation to K: Small effect on electron transfer.
Sites not aligning to the query:
- 95 E→K: 20000-fold decrease in electron transfer.
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
45% identity, 20% coverage: 289:362/370 of query aligns to 12:85/98 of 1ewyC
- binding flavin-adenine dinucleotide: A45 (≠ L322), S64 (≠ A341)
- binding fe2/s2 (inorganic) cluster: F39 (≠ Y316), S40 (= S317), C41 (= C318), R42 (≠ Q319), G44 (= G321), A45 (≠ L322), C46 (= C323), C49 (= C326), L77 (= L354), C79 (= C356)
Query Sequence
>Echvi_0363 FitnessBrowser__Cola:Echvi_0363
MIFNLFKKHKGEKKRGSQYLSLKVREVVRETPDAVTIYFEQPEPYLEYKPGQFLTLILDI
NGKEERRSYSLCTSPYVDPHPGITVKRIAGGVVSNYLNESIKPGKTIEVMKPMGHFTADF
HSKNKNHFIMIAGGSGITPIMGIAKSVLINEPESKVTLIYCNRSEEQVIFDQAIQKLVNE
QKRRFEVVHTLSRPSGDWSGLQGRLDEQMIEQVLEEKHFAAADKELYYLCGPEGLMEASV
EALLKLDVPHENIHRESFYTSSSEEAEKEAETDAADQPALTRSVTIDLEGEEHTFEVPPG
KTILEAGLDEGYDMPYSCQSGLCTACRGRLSSGEVKMEQDAGLSDGEKKDGYILCCVSYP
KSGDVKVDIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory