Comparing Echvi_0398 FitnessBrowser__Cola:Echvi_0398 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
51% identity, 92% coverage: 38:752/774 of query aligns to 3:710/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
51% identity, 92% coverage: 38:752/774 of query aligns to 3:710/715 of 2x42A
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
40% identity, 86% coverage: 89:752/774 of query aligns to 32:648/674 of 5wabA
6jbsA Bifunctional xylosidase/glucosidase lxyl (see paper)
31% identity, 86% coverage: 75:741/774 of query aligns to 45:753/762 of 6jbsA
7yo7A Bifunctional xylosidase/glucosidase lxyl with intermediate substrate xylose, 5 seconds
30% identity, 86% coverage: 75:741/774 of query aligns to 40:748/756 of 7yo7A
7ey1B Bifunctional xylosidase/glucosidase lxyl with intermediate substrate xylose
30% identity, 86% coverage: 75:741/774 of query aligns to 40:748/756 of 7ey1B
6jbsC Bifunctional xylosidase/glucosidase lxyl (see paper)
30% identity, 86% coverage: 75:741/774 of query aligns to 44:752/761 of 6jbsC
6kj0A Bifunctional xylosidase/glucosidase lxyl mutant e529q c2221 (see paper)
30% identity, 86% coverage: 75:741/774 of query aligns to 40:748/756 of 6kj0A
7ey2C Bifunctional xylosidase/glucosidase lxyl d300n mutant with intermediate substrate xylose
30% identity, 86% coverage: 75:741/774 of query aligns to 39:747/756 of 7ey2C
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
30% identity, 82% coverage: 118:749/774 of query aligns to 113:741/763 of 7zdyW
Sites not aligning to the query:
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
30% identity, 82% coverage: 118:749/774 of query aligns to 113:750/772 of 8c7fA
Sites not aligning to the query:
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
31% identity, 81% coverage: 116:742/774 of query aligns to 88:728/742 of 3u48B
Sites not aligning to the query:
3ac0A Crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose (see paper)
38% identity, 45% coverage: 81:426/774 of query aligns to 28:379/841 of 3ac0A
Sites not aligning to the query:
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
31% identity, 80% coverage: 116:738/774 of query aligns to 84:722/733 of 6r5nA
Sites not aligning to the query:
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
31% identity, 80% coverage: 116:738/774 of query aligns to 84:722/733 of 6r5iA
6r5tA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with lactose (see paper)
31% identity, 80% coverage: 116:738/774 of query aligns to 84:722/733 of 6r5tA
Sites not aligning to the query:
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
31% identity, 80% coverage: 116:738/774 of query aligns to 84:719/730 of 6r5vA
Sites not aligning to the query:
6r5oA The crystal structure the glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with two glucose molecules (see paper)
31% identity, 80% coverage: 116:738/774 of query aligns to 84:719/730 of 6r5oA
Sites not aligning to the query:
5wvpA Expression, characterization and crystal structure of a novel beta- glucosidase from paenibacillus barengoltzii
40% identity, 39% coverage: 29:332/774 of query aligns to 481:792/924 of 5wvpA
Sites not aligning to the query:
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
28% identity, 91% coverage: 38:744/774 of query aligns to 7:729/733 of 5tf0A
>Echvi_0398 FitnessBrowser__Cola:Echvi_0398
MKFSNHIKYSTLLLLSSFLTINLSCTTDKHPRLGESPVQEVIDAMTIEEKSLMVTGAKRR
EVVPVPLPGRKQKNITAVGGYTYPFVHLGIPSIMLSDGPAGLRIAPRRPNDPETYYCTAF
PVGTLVASSWDPQLVEKVGNAMGHEALEYGVDILLSPAMNIHRDPLGGRSFEYYSEDPLI
SGKMGAALVRGIQSQGIGTAIKHFVANNQETNRRTIDAVVSERALREIYLRGFEIAVKEG
DPWTVMSSYNKVNGTYTPQSEELLEIILRKEWGFDGFVLTDWYGGDDPVEQMKAGNDLLM
PGLQDWSDAIAEALENGSLEKELVDRNIARILDVITRTSTYKDYPYSNKPNFKESIKIAR
EAAGESMVLLKNDADILPLKPDIKKVAPFGNYSYKLTVGGTGSGMVNNEYSISLAQGLEN
AGYEIDAALHEKYTDYLKKGKPQNLEADSLITAMPKPDSILGELPLDASLIRQNAEESDI
AMVSIMRVFGEGGDRKLETFYLTEEEKNLLKNVSEAFRAKGKKVVVVLNIGGVIETASWR
ELADAILLAWQPGQEGGNAMADILTGKVNPSGKLATTFPLDYPDVPTTKNFPGTPAENPE
KVVHEEGIYVGYRYYDSFAVNPAYEFGFGLSYTDFSYDNLKLGSETFENEIEVTADIKNT
GNKAGREVVQLYLAAPGKAMDKPVKELKNFAKTKLLAPGESQTITFVLDARSLASFVSER
SAWIAEAGKYTVHVGASSRDIRKSAGFDLEKELTVEKVHKVLVPQEKISEFKRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory