Comparing Echvi_0478 FitnessBrowser__Cola:Echvi_0478 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3fwnB Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
39% identity, 71% coverage: 168:618/636 of query aligns to 6:456/467 of 3fwnB
3fwnA Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
39% identity, 71% coverage: 168:618/636 of query aligns to 6:456/467 of 3fwnA
P00350 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Escherichia coli (strain K12) (see paper)
39% identity, 71% coverage: 168:618/636 of query aligns to 7:457/468 of P00350
2zydA Dimeric 6-phosphogluconate dehydrogenase complexed with glucose (see paper)
39% identity, 71% coverage: 168:618/636 of query aligns to 5:455/464 of 2zydA
7cb2A The 6-phosphogluconate dehydrogenase (NADP-bound) from staphylococcus aureus
38% identity, 71% coverage: 167:618/636 of query aligns to 5:456/466 of 7cb2A
7cb5B The 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound) (see paper)
38% identity, 71% coverage: 167:618/636 of query aligns to 5:456/467 of 7cb5B
2w90B Geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate (see paper)
38% identity, 74% coverage: 163:631/636 of query aligns to 4:471/471 of 2w90B
2iz1B 6pdh complexed with pex inhibitor synchrotron data (see paper)
38% identity, 72% coverage: 163:618/636 of query aligns to 4:461/471 of 2iz1B
2iyoA Structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition (see paper)
38% identity, 72% coverage: 163:618/636 of query aligns to 2:459/470 of 2iyoA
P96789 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Lactococcus lactis subsp. cremoris (strain MG1363) (see paper)
38% identity, 72% coverage: 163:618/636 of query aligns to 2:459/472 of P96789
2iypB Product rup (see paper)
38% identity, 72% coverage: 163:618/636 of query aligns to 3:460/470 of 2iypB
2iypA Product rup (see paper)
38% identity, 72% coverage: 163:618/636 of query aligns to 2:459/469 of 2iypA
8i4qA Crystal structure of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum (see paper)
34% identity, 74% coverage: 164:635/636 of query aligns to 2:476/479 of 8i4qA
P78812 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 73% coverage: 160:623/636 of query aligns to 2:466/492 of P78812
6fqzA Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate (see paper)
35% identity, 72% coverage: 164:618/636 of query aligns to 1:459/468 of 6fqzA
6fqyA Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate (see paper)
35% identity, 72% coverage: 164:618/636 of query aligns to 1:459/468 of 6fqyA
1pgqA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
39% identity, 73% coverage: 163:627/636 of query aligns to 1:467/473 of 1pgqA
1pgpA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
39% identity, 73% coverage: 163:627/636 of query aligns to 1:467/473 of 1pgpA
1pgoA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
39% identity, 73% coverage: 163:627/636 of query aligns to 1:467/473 of 1pgoA
1pgnA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
39% identity, 73% coverage: 163:627/636 of query aligns to 1:467/473 of 1pgnA
>Echvi_0478 FitnessBrowser__Cola:Echvi_0478
MIILLMGVSGSGKTTIGRMLSGKVGLPFYDADDFHPKNNVEKMKAGIPLNDQDRVPWLET
LSEKMVAWEENGGAILACSALKASYRKMLRSHAVQMRWFFLKGDEALIAKRMKAREGHYM
PASLLSSQLETLEPPKHATIISIDQTPENILEDIMSDLKNNKAVSSFGIIGMGVMGSSLA
LNLAEKDVKISVYNRTLQGVEEDVAQKLVDAHPEVKGILPFDKLDEFVESLEQPRKILMM
IPAGQIVDQQIARLLTFVDKGDVIIDGGNSFFEDSAKRQQYLQGYGIHFVGMGISGGRDG
ALKGPSLMPGGSEEGFELIKPYLEKIAGKDKGGKPCMHYVGPDGAGHFIKMVHNSIEYGE
IQVLAELYGFMRKGLGMSIEEMVKTFKTWSKEGADSYLMDATLAILSHEKDGKLLLDGIL
DVAGQTGTGGWAVSTAAKYGVPYAPLTAAVTARLVSTHKEARVSFAQTYPRKTDEIDQKE
IIDALKGAYDMARLVNHEIGFSLIKKVGEAEKWGLNMSEIARCWTNGSIIQSSLMEKLAG
VFKSTDCLMASAALKASFENGAKTLAEVVGAGLKAGIAMPVMSAAINFFYGMSSGQSSAN
LVQALRDCFGEHGYRLVDDVSGKIHRNKWRKSKEEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory