SitesBLAST
Comparing Echvi_0507 FitnessBrowser__Cola:Echvi_0507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
33% identity, 93% coverage: 1:315/337 of query aligns to 4:316/337 of 4ilkA
- active site: C40 (= C37), G41 (= G38), S42 (≠ T39), H45 (= H42), H59 (= H59), E60 (= E60), C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102), A107 (≠ S106), P145 (= P143), A149 (≠ G147)
- binding manganese (ii) ion: C40 (= C37), H59 (= H59), E60 (= E60), E144 (= E142)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G166), G170 (= G168), P171 (= P169), I172 (= I170), D193 (= D189), R194 (≠ I190), R198 (= R194), N213 (≠ A210), A235 (= A233), A236 (≠ T234), C237 (≠ G235), I241 (≠ A239), M258 (≠ V256), F260 (≠ L258)
- binding zinc ion: C89 (= C88), C92 (= C91), C95 (= C94), C103 (= C102)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
31% identity, 95% coverage: 1:319/337 of query aligns to 5:332/348 of O58389
- C42 (= C37) binding
- T44 (= T39) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C88) binding
- C100 (= C91) binding
- C103 (= C94) binding
- C111 (= C102) binding
- E152 (= E142) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I170) binding
- E199 (≠ I190) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ L195) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGL 256:258) binding
- IT 291:292 (≠ SS 279:280) binding
- R294 (≠ N282) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
31% identity, 95% coverage: 1:319/337 of query aligns to 3:330/346 of 2dfvA
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H65 (= H59), E66 (= E60), C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102), K113 (≠ S106), P151 (= P143), A155 (≠ G147)
- binding nicotinamide-adenine-dinucleotide: G175 (= G168), P176 (= P169), L177 (≠ I170), E197 (≠ I190), P198 (≠ N191), R202 (≠ L195), F241 (≠ A233), S242 (≠ T234), A244 (≠ S236), L264 (≠ V256), G265 (= G257), L266 (= L258), I289 (≠ S279), T290 (≠ S280)
- binding zinc ion: C95 (= C88), C101 (= C94), C109 (= C102)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
29% identity, 97% coverage: 9:336/337 of query aligns to 11:345/347 of 5vm2A
- active site: C39 (= C37), G40 (= G38), S41 (≠ T39), H44 (= H42), H65 (= H59), E66 (= E60), C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102), D113 (≠ S106), P153 (= P143), G157 (= G147), K340 (= K331)
- binding magnesium ion: H65 (= H59), E66 (= E60), E152 (= E142)
- binding zinc ion: C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102)
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
32% identity, 84% coverage: 11:292/337 of query aligns to 13:305/357 of 7y9pA
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
31% identity, 95% coverage: 1:319/337 of query aligns to 3:330/347 of 3gfbA
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H65 (= H59), E66 (= E60), C95 (= C88), C98 (= C91), C101 (= C94), C109 (= C102), K113 (≠ S106), P151 (= P143), A155 (≠ G147)
- binding nicotinamide-adenine-dinucleotide: G173 (= G166), G175 (= G168), P176 (= P169), L177 (≠ I170), S196 (≠ M188), E197 (≠ D189), P198 (≠ I190), R202 (= R194), F241 (≠ A233), S242 (≠ T234), A244 (≠ S236), L264 (≠ V256), G265 (= G257), L266 (= L258), I289 (≠ S279), T290 (≠ S280)
Sites not aligning to the query:
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
31% identity, 95% coverage: 1:319/337 of query aligns to 5:332/350 of Q5JI69
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
31% identity, 83% coverage: 1:280/337 of query aligns to 4:305/343 of 4ej6A
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H61 (= H59), E62 (= E60), C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102), R109 (≠ S106), P147 (= P143), C151 (≠ G147)
- binding zinc ion: C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
31% identity, 83% coverage: 1:280/337 of query aligns to 4:305/342 of 4ejmA
- active site: C40 (= C37), G41 (= G38), T42 (= T39), H45 (= H42), H61 (= H59), E62 (= E60), C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102), R109 (≠ S106), P147 (= P143), C151 (≠ G147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G166), G172 (= G168), V173 (≠ P169), I174 (= I170), T194 (≠ I190), R195 (≠ N191), Q196 (≠ E192), K199 (≠ L195), C240 (≠ A233), E245 (≠ V238), T246 (≠ A239), L263 (≠ V256), V265 (≠ L258), I291 (≠ N266)
- binding zinc ion: C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102)
Sites not aligning to the query:
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
29% identity, 94% coverage: 18:334/337 of query aligns to 17:344/348 of 1e3jA
- active site: C38 (= C37), G39 (= G38), S40 (≠ T39), H43 (= H42), H63 (= H59), E64 (= E60), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), T111 (≠ S106), P150 (= P143), G154 (= G147), K341 (= K331)
- binding phosphate ion: A174 (= A167), A196 (≠ D189), R197 (≠ I190), S198 (≠ N191), R201 (= R194)
- binding zinc ion: C38 (= C37), H63 (= H59), E64 (= E60), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102)
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
30% identity, 89% coverage: 20:319/337 of query aligns to 21:326/343 of 2ejvA
- active site: C38 (= C37), G39 (= G38), T40 (= T39), H43 (= H42), H63 (= H59), E64 (= E60), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), Q111 (≠ S106), P149 (= P143), A153 (≠ G147)
- binding nicotinamide-adenine-dinucleotide: G172 (= G166), G174 (= G168), P175 (= P169), I176 (= I170), S195 (≠ M188), D196 (= D189), P197 (≠ I190), R201 (= R194), F238 (≠ A233), S239 (≠ T234), N241 (≠ S236), A244 (= A239), L261 (≠ V256), G262 (= G257), I263 (≠ L258)
- binding zinc ion: C38 (= C37), H63 (= H59), E64 (= E60), C96 (= C91), C99 (= C94), C107 (= C102)
Sites not aligning to the query:
2dq4A Crystal structure of threonine 3-dehydrogenase
30% identity, 89% coverage: 20:319/337 of query aligns to 21:326/343 of 2dq4A
- active site: C38 (= C37), G39 (= G38), T40 (= T39), H43 (= H42), H63 (= H59), E64 (= E60), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), Q111 (≠ S106), P149 (= P143), A153 (≠ G147)
- binding zinc ion: C38 (= C37), H63 (= H59), E64 (= E60), C93 (= C88), C96 (= C91), C107 (= C102)
Sites not aligning to the query:
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
30% identity, 89% coverage: 20:319/337 of query aligns to 21:326/343 of Q5SKS4
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
29% identity, 89% coverage: 1:301/337 of query aligns to 4:315/347 of 2eerB
- active site: C38 (= C37), H39 (≠ G38), S40 (≠ T39), H43 (= H42), H68 (= H59), E69 (= E60), E98 (≠ C88), C101 (= C91), C104 (= C94), C112 (= C102), R116 (≠ S106), C154 (≠ A148), T158 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: C38 (= C37), H39 (≠ G38), S40 (≠ T39), H43 (= H42), C154 (≠ A148), T158 (vs. gap), G178 (= G166), G181 (≠ P169), G182 (= G171), L183 (= L172), D203 (= D189), V204 (≠ I190), R205 (≠ N191), L247 (≠ A233), N248 (≠ T234), V270 (= V256), G271 (= G257), L272 (= L258), F273 (≠ Q259), L295 (≠ R281), V296 (≠ N282)
- binding zinc ion: E98 (≠ C88), C101 (= C91), C104 (= C94), C112 (= C102)
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
28% identity, 99% coverage: 1:335/337 of query aligns to 5:342/348 of 5ylnA
2eihA Crystal structure of NAD-dependent alcohol dehydrogenase
31% identity, 87% coverage: 9:301/337 of query aligns to 12:310/343 of 2eihA
- active site: N40 (≠ C37), H41 (≠ G38), L42 (≠ T39), W45 (≠ H42), A63 (≠ H59), D64 (≠ E60), C93 (= C88), C96 (= C91), C99 (= C94), C107 (= C102), Q111 (≠ S106), L149 (= L144), T153 (≠ A148)
- binding zinc ion: C96 (= C91), C99 (= C94), C107 (= C102)
Sites not aligning to the query:
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
29% identity, 96% coverage: 1:323/337 of query aligns to 2:327/339 of 5kiaA
- active site: C37 (= C37), G38 (= G38), T39 (= T39), H42 (= H42), H61 (= H59), E62 (= E60), C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102), V109 (≠ S106), P147 (= P143), A151 (≠ G147)
- binding calcium ion: D146 (≠ E142), N150 (≠ I146), E288 (= E286)
- binding zinc ion: C91 (= C88), C94 (= C91), C97 (= C94), C105 (= C102)
Sites not aligning to the query:
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
28% identity, 93% coverage: 22:335/337 of query aligns to 51:374/377 of Q96V44
- DI 224:225 (= DI 189:190) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (≠ L323) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
29% identity, 89% coverage: 20:319/337 of query aligns to 21:325/341 of P07913
- C38 (= C37) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
1vj0A Crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution
33% identity, 76% coverage: 14:270/337 of query aligns to 19:300/366 of 1vj0A
- active site: C42 (= C37), G43 (= G38), S44 (≠ T39), H47 (= H42), H64 (= H59), E65 (= E60), C99 (= C88), C102 (= C91), C105 (= C94), C114 (= C102), K118 (≠ S106), C165 (≠ A145), T169 (≠ H149)
- binding zinc ion: C42 (= C37), H64 (= H59), E65 (= E60), C99 (= C88), C102 (= C91), C105 (= C94), C114 (= C102), C165 (≠ A145)
Sites not aligning to the query:
Query Sequence
>Echvi_0507 FitnessBrowser__Cola:Echvi_0507
MKILTCTEPGNFEYSEGEKPTLSPGRAIIKIKRIGICGTDLHAYEGTQPFFNYPRVLGHE
LSGELVEVDGAEGFVPGDLVTIIPYFNCGECVACKAGKPNCCATISVFGVHEDGGMKEFI
SVPSSSLVKQEGLSLEQLALAEPLAIGAHGVRRAGVQPGEFVVVMGAGPIGLGVMEFARI
AGGKVIAMDINEDRLAFCRETLGVEYTVNAKGDFKAAIADITGGSFAESVIDATGSSVAI
HHGFGLMAHGGRYVLVGLQKGPIEFNHPEFHKRESTLMSSRNATREDFDTVLKALKEQKV
KAASYITHEVAFDQVKADFASWLDPANKVIKAMVRLQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory