Comparing Echvi_0515 FitnessBrowser__Cola:Echvi_0515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
37% identity, 96% coverage: 4:544/562 of query aligns to 1:524/546 of 3qdkA
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
25% identity, 98% coverage: 5:552/562 of query aligns to 3:541/541 of 3l0qA
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
30% identity, 24% coverage: 405:539/562 of query aligns to 349:484/496 of P18157
Sites not aligning to the query:
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
30% identity, 19% coverage: 405:508/562 of query aligns to 349:452/498 of Q5HGD2
Sites not aligning to the query:
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
30% identity, 19% coverage: 405:508/562 of query aligns to 350:453/499 of 3ge1A
Sites not aligning to the query:
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
31% identity, 22% coverage: 405:530/562 of query aligns to 350:473/501 of O34154
Sites not aligning to the query:
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 55% coverage: 231:538/562 of query aligns to 192:473/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 55% coverage: 231:538/562 of query aligns to 192:473/478 of 5ya1A
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
30% identity, 19% coverage: 405:508/562 of query aligns to 351:454/506 of O34153
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
30% identity, 19% coverage: 405:508/562 of query aligns to 350:453/501 of 3h3nX
Sites not aligning to the query:
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
22% identity, 52% coverage: 252:546/562 of query aligns to 215:477/490 of 3ll3B
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
30% identity, 22% coverage: 409:529/562 of query aligns to 356:472/497 of O86033
Sites not aligning to the query:
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
22% identity, 52% coverage: 252:546/562 of query aligns to 216:479/492 of 3ll3A
Sites not aligning to the query:
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
27% identity, 19% coverage: 405:508/562 of query aligns to 358:462/507 of 2w41B
Sites not aligning to the query:
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
27% identity, 19% coverage: 405:508/562 of query aligns to 352:456/501 of 2w40A
Sites not aligning to the query:
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
28% identity, 19% coverage: 403:508/562 of query aligns to 344:449/495 of 6udeB
Sites not aligning to the query:
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
28% identity, 17% coverage: 416:508/562 of query aligns to 356:448/494 of 1gllO
Sites not aligning to the query:
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
28% identity, 17% coverage: 416:508/562 of query aligns to 356:448/494 of 1gljO
Sites not aligning to the query:
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
28% identity, 17% coverage: 416:508/562 of query aligns to 356:448/494 of 1bwfO
Sites not aligning to the query:
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
28% identity, 17% coverage: 416:508/562 of query aligns to 351:443/489 of 1gldG
Sites not aligning to the query:
>Echvi_0515 FitnessBrowser__Cola:Echvi_0515
MNDKFVIGLDYGSDSVRAVIVNTGNGEVKGSHVFWYPRWKAGKYCDPVNNQFRQHPLDHL
EGLEETIREVIKESGVPADQIKGICVDTTGSSPMAVDQQGKPLALSPEFAENPNAMMVLW
KDHTAIKEADEINELARTWGGEDYTKYEGGIYSSEWFWAKILHVIREDDAVAQAAYSWME
HCDVITAELIGADNPLDVKRSRCAAGHKALWHESWDGLPPKEFLSKLDPRLADLRDRLYT
ETFTSDLPAGNLSAEWAKKLGLSTDTVIAVGTFDAHAGAVGGEVTENTLVKVMGTSTCDI
MVATHEAIGDNLVKGICGQVDGSVIPGTVGLEAGQSGFGDVLAWFKHLVVKPTAALIRAS
NVLDEEKKEALIHEIDSQLLIKLSEEAIQIPLSETAPVALDWVNGRRTPDANQALKGAVM
GLNMGTDAARVFKALVESICFGSKKIVDRFREEGVAIDTVIGMGGVAKKSKLVMQTMADV
LNMPIKIATSDQAPALGAAMYASVAAGIHPTTEAAIAAMTNGFDKVYEPIPENVEVYKAL
YAKYAEFGAFVEGQTSPVLADQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory