SitesBLAST
Comparing Echvi_0565 FitnessBrowser__Cola:Echvi_0565 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
23% identity, 43% coverage: 84:292/488 of query aligns to 49:218/390 of F0M433
- T81 (= T117) binding
- N83 (≠ D119) binding
- H86 (= H122) binding
- E103 (≠ Q139) binding
- K104 (= K140) binding ; binding
- A130 (≠ G166) binding
- N132 (≠ Q168) binding
- Y133 (≠ G169) binding
- Q163 (= Q204) binding
- W175 (= W243) binding
- R176 (= R244) binding ; binding
- D189 (= D256) binding
- H193 (= H260) binding
Sites not aligning to the query:
- 13 binding
- 14 binding
- 43 binding
- 335 binding
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
23% identity, 43% coverage: 84:292/488 of query aligns to 47:216/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: T79 (= T117), P80 (= P118), N81 (≠ D119), H84 (= H122), E101 (≠ Q139), K102 (= K140), W173 (= W243), R174 (= R244)
- binding alpha-L-sorbopyranose: K102 (= K140), Y131 (≠ G169), Y159 (≠ W202), Q161 (= Q204), W163 (≠ P213), R174 (= R244), D187 (= D256)
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
23% identity, 43% coverage: 84:292/488 of query aligns to 48:217/372 of 6a3iA
- binding Levoglucosan: K103 (= K140), Y132 (≠ G169), Y160 (≠ W202), Q162 (= Q204), R175 (= R244), D188 (= D256), H192 (= H260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: P81 (= P118), N82 (≠ D119), L84 (≠ V121), H85 (= H122), E102 (≠ Q139), K103 (= K140), W174 (= W243), R175 (= R244)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
23% identity, 48% coverage: 63:297/488 of query aligns to 27:221/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (= D77), I39 (≠ V78), T78 (= T117), P79 (= P118), N80 (≠ D119), H83 (= H122), E100 (≠ Q139), K101 (= K140), P102 (= P141), F170 (≠ W225), Q176 (≠ K231), H187 (= H260)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
28% identity, 31% coverage: 45:194/488 of query aligns to 3:149/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ N167)
- binding nicotinamide-adenine-dinucleotide: G10 (= G52), G12 (= G54), R13 (≠ G55), A14 (≠ K56), D35 (= D77), P36 (≠ V78), R37 (≠ S81), A71 (≠ S116), S72 (≠ T117), P73 (= P118), F76 (≠ V121), Q80 (≠ A125), E94 (≠ Q139), K95 (= K140), P96 (= P141)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
24% identity, 42% coverage: 94:297/488 of query aligns to 46:211/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K140), R150 (≠ Q204), W157 (= W222), F160 (≠ W225), D173 (= D256), H177 (= H260)
- binding nicotinamide-adenine-dinucleotide: D51 (= D99), Y52 (≠ F100), C67 (≠ S116), T68 (= T117), P69 (= P118), H73 (= H122), E90 (≠ Q139), K91 (= K140), P92 (= P141), Q119 (= Q168), V159 (≠ L224), F160 (≠ W225), Q166 (≠ K231)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
22% identity, 45% coverage: 45:264/488 of query aligns to 7:192/347 of 3q2kC
- active site: K100 (= K140), H188 (= H260)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ G55), K100 (= K140), W159 (= W225), T160 (≠ L226), R161 (≠ G227), Y165 (≠ K231), N184 (≠ D256), Q185 (≠ V257), H188 (= H260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G54), R17 (≠ G55), I18 (≠ K56), D40 (= D77), T41 (≠ V78), A76 (≠ S116), T77 (= T117), S79 (≠ D119), H82 (= H122), Q85 (≠ A125), E99 (≠ Q139), K100 (= K140), Q128 (= Q168), W171 (= W243), R172 (= R244)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
22% identity, 45% coverage: 45:264/488 of query aligns to 2:187/322 of 3q2kK
- active site: K95 (= K140), H183 (= H260)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ G55), K95 (= K140), T155 (≠ L226), R156 (≠ G227), Y160 (≠ K231), N179 (≠ D256), Q180 (≠ V257), H183 (= H260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G52), G11 (= G54), R12 (≠ G55), I13 (≠ K56), D35 (= D77), T36 (≠ V78), T72 (= T117), P73 (= P118), S74 (≠ D119), L76 (≠ V121), H77 (= H122), E94 (≠ Q139), K95 (= K140), Q123 (= Q168), W166 (= W243), R167 (= R244), H183 (= H260)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
24% identity, 30% coverage: 72:217/488 of query aligns to 37:187/374 of 3dtyA
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
29% identity, 24% coverage: 43:159/488 of query aligns to 2:110/309 of Q53TZ2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 169 D→A: Loss of activity.
- 173 N→A: Decrease by 4 orders of magnitude in catalytic efficiency.
7bvjA Udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) (see paper)
30% identity, 16% coverage: 109:188/488 of query aligns to 60:146/313 of 7bvjA
Sites not aligning to the query:
- binding (2R,3R)-2,3-bis(oxidanyl)butane-1,4-disulfonic acid: 223, 230, 232
- binding nicotinamide-adenine-dinucleotide: 12, 13, 14, 32, 33, 34, 38
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
28% identity, 21% coverage: 95:195/488 of query aligns to 65:169/379 of 7d5nA
Sites not aligning to the query:
- binding 1,4-dihydronicotinamide adenine dinucleotide: 17, 19, 22, 23, 24, 46, 47, 185, 186, 199, 323
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
28% identity, 21% coverage: 95:195/488 of query aligns to 65:169/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K140), Y143 (≠ G169)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T91 (= T117), P92 (= P118), N93 (≠ D119), H96 (= H122), E113 (≠ Q139), K114 (= K140)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 190, 204, 208
- binding 1,4-dihydronicotinamide adenine dinucleotide: 17, 19, 22, 23, 24, 46, 47, 189, 190, 208, 332
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
28% identity, 21% coverage: 95:195/488 of query aligns to 66:170/389 of 7d5mA
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 18, 20, 23, 24, 25, 47, 48, 190, 191, 209, 333
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
38% identity, 13% coverage: 97:159/488 of query aligns to 45:107/306 of 7cgqA
Sites not aligning to the query:
- binding alpha-L-arabinopyranose: 116, 150, 167, 170
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 34, 35, 36, 116, 153, 155, 166, 263
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
22% identity, 40% coverage: 69:264/488 of query aligns to 36:196/345 of 3q2iA
- active site: K104 (= K140), H192 (= H260)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (= K140), N133 (≠ G169), T164 (≠ L226), R165 (≠ G227), Y169 (≠ K231), N188 (≠ D256), Q189 (≠ V257), H192 (= H260)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D44 (= D77), I45 (≠ V78), T81 (= T117), P82 (= P118), S83 (≠ D119), H86 (= H122), E103 (≠ Q139), K104 (= K140), Q132 (= Q168), W175 (= W243), R176 (= R244), H192 (= H260)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 247, 248
- binding 1,4-dihydronicotinamide adenine dinucleotide: 19, 20, 21, 22
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
23% identity, 32% coverage: 46:203/488 of query aligns to 4:162/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G52), G12 (= G54), A13 (≠ G55), Q14 (≠ K56), D36 (= D77), S37 (≠ V78), R41 (≠ A84), A73 (≠ S116), G74 (≠ T117), L78 (≠ V121), E96 (≠ Q139), K97 (= K140), N125 (= N167)
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
21% identity, 48% coverage: 46:277/488 of query aligns to 3:200/336 of 3ec7A
- active site: K97 (= K140), H176 (= H239)
- binding nicotinamide-adenine-dinucleotide: G11 (= G54), M12 (≠ G55), I13 (≠ K56), D35 (= D77), I36 (≠ V78), R40 (≠ S83), T73 (≠ S116), A74 (≠ T117), S75 (≠ P118), N76 (≠ D119), H79 (= H122), E96 (≠ Q139), K97 (= K140), M126 (≠ Q168)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
29% identity, 23% coverage: 47:157/488 of query aligns to 5:111/348 of 3e18A
- active site: K94 (= K140)
- binding nicotinamide-adenine-dinucleotide: G12 (= G54), G13 (= G55), M14 (≠ K56), F34 (≠ C76), D35 (= D77), I36 (≠ V78), K40 (≠ G82), A70 (≠ S116), T71 (= T117), P72 (= P118), N73 (≠ D119), H76 (= H122), E93 (≠ Q139), K94 (= K140)
Sites not aligning to the query:
6t2bB Glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and NAD+.
27% identity, 31% coverage: 38:187/488 of query aligns to 25:186/439 of 6t2bB
- binding nicotinamide-adenine-dinucleotide: G40 (= G52), G43 (= G55), R44 (≠ K56), D65 (= D77), L66 (≠ V78), D93 (≠ K95), S111 (= S116), T112 (= T117), W114 (≠ D119), H117 (= H122), E134 (≠ Q139), V135 (≠ K140), N163 (≠ M165)
Sites not aligning to the query:
Query Sequence
>Echvi_0565 FitnessBrowser__Cola:Echvi_0565
MEKPKKSIDQHSRRNFIKNAALASSALIVPRHVLGGVGFTAPSDQLNIAAIGAGGKGASD
IKNASVNGRERVVALCDVDFSGSASQSVKNFPNAKLYADFREMLEKEKDIDAVTISTPDH
VHGPAAAFAMERGKHVYVQKPMTHNIREARLLTQMAREQKVVTQMGNQGGSNPLLNLVQQ
WIDSDKLGKISKVEIWTNRPVWPQGNAFPQPDPSKKPDDLAWDLWLGPSPKIPYTPNLHP
FNWRGWWDYGTGALGDVGCHLVDIPYRTLGLHYPKSAECSVGAVYTKMWTPDYHPEGCPA
SSFISLKFDATEKSKSPIEMTWSDGGIRPAHPDIIPADHDIGGTDSANGVLIIGEKGIIS
TNINDSSPLMPKLYLNDGTTEFGPQTEDFPEPEYGHQRKWVDACKAGFGSKEHNELTSSF
DYAGPMTETVLMGNLAIRSYMLRRENSNGGMEYFGRKKLLWDGDNMQITNLEEANQYVGR
TYRDGWKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory