Comparing Echvi_0600 FitnessBrowser__Cola:Echvi_0600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4rqoB Crystal structure of l-serine dehydratase from legionella pneumophila (see paper)
34% identity, 91% coverage: 3:278/302 of query aligns to 165:445/448 of 4rqoB
Sites not aligning to the query:
Q58431 L-cysteine desulfidase; L-cysteine desulfhydrase; EC 4.4.1.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
23% identity, 78% coverage: 29:263/302 of query aligns to 131:374/388 of Q58431
Sites not aligning to the query:
>Echvi_0600 FitnessBrowser__Cola:Echvi_0600
MSYLFETFQGWKEYCEAKNVPLYAPVMEYEKDQRGKSEEQIWEGLRSAYKVMKDAVETGL
KEEMVSRSGMINNGAKKVYHHPLSVLSPEFQRLISRALAAKEVNSCMGRVVAAPTAGASG
ILPGTLYTLQEIHGLSDDKVLEGLLIGAGVALIIEQNASLAGAVGGCQAETGSAAAMASG
AMVYCLGGNTDQVFNAVAITIQCMLGLVCDPVAGLVEIPCVVRNASAAAIANSSAQIALA
DVSGVIPVDECVEAMGEIGASMENKYKETALGGLAATLTGKGIAKKVLIQDIEILPDEES
TD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory