Comparing Echvi_0658 FitnessBrowser__Cola:Echvi_0658 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
41% identity, 93% coverage: 1:182/196 of query aligns to 1:184/187 of P00903
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
39% identity, 92% coverage: 3:182/196 of query aligns to 7:187/673 of 8hx8A
Sites not aligning to the query:
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 93% coverage: 2:184/196 of query aligns to 75:265/276 of Q42565
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
32% identity, 92% coverage: 2:181/196 of query aligns to 4:185/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
32% identity, 92% coverage: 2:181/196 of query aligns to 3:184/192 of 1i7qB
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
34% identity, 94% coverage: 1:184/196 of query aligns to 1:176/183 of 7yc6A
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
31% identity, 92% coverage: 3:182/196 of query aligns to 6:144/632 of 8hx9A
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
24% identity, 93% coverage: 1:182/196 of query aligns to 1:180/475 of 2ywcA
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
31% identity, 76% coverage: 21:168/196 of query aligns to 195:338/2225 of P27708
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
24% identity, 92% coverage: 2:182/196 of query aligns to 6:187/490 of 5tw7F
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
28% identity, 79% coverage: 42:196/196 of query aligns to 213:366/2225 of P08955
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
21% identity, 96% coverage: 2:189/196 of query aligns to 8:198/501 of 1gpmA
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 75% coverage: 23:169/196 of query aligns to 263:405/430 of Q9LVW7
Sites not aligning to the query:
3uowB Crystal structure of pf10_0123, a gmp synthetase from plasmodium falciparum
24% identity, 71% coverage: 44:183/196 of query aligns to 40:179/477 of 3uowB
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
27% identity, 68% coverage: 36:168/196 of query aligns to 225:355/2224 of P05990
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
21% identity, 92% coverage: 2:182/196 of query aligns to 6:181/658 of 2vxoB
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
20% identity, 92% coverage: 2:182/196 of query aligns to 28:206/693 of P49915
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
26% identity, 76% coverage: 21:168/196 of query aligns to 198:341/2198 of Q18990
Sites not aligning to the query:
P07259 Multifunctional protein URA2; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 65% coverage: 43:169/196 of query aligns to 265:389/2214 of P07259
Sites not aligning to the query:
P07258 Carbamoyl phosphate synthase arginine-specific small chain; CPS; CPSase; CPSase-arg; Arginine-specific carbamoyl phosphate synthetase, glutamine chain; Carbamoyl phosphate synthase A; CPS-A; Glutamine-dependent carbamoyl phosphate synthetase; EC 6.3.5.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 67% coverage: 39:169/196 of query aligns to 220:352/411 of P07258
>Echvi_0658 FitnessBrowser__Cola:Echvi_0658
MLLLIDNFDSFSHILADYFRQAGFDLHIVRNDTPLAVLMEGKYEGLVLSPGPETPAKAGN
LQEIFEYFHDKLPVLGVCLGHQCIGTFFGAKLVTGARPVHGKVYSVTKRLDHPMLNGLPE
RFLVTRYHSLELKDLPDCLQPLLYTEQGALMAMVHQTLPIVGIQYHPEAYLSEYGLQVIQ
NWGKCYVRDGQSRNEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory