SitesBLAST
Comparing Echvi_0722 Echvi_0722 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6kgyB Hocl-induced flavoprotein disulfide reductase rcla from escherichia coli (see paper)
35% identity, 100% coverage: 1:458/458 of query aligns to 1:441/441 of 6kgyB
- active site: C43 (= C41), C48 (= C46), T51 (= T49), Y168 (= Y183), E172 (= E187), H426 (= H443), E431 (= E448)
- binding flavin-adenine dinucleotide: I9 (≠ L9), G12 (= G12), E33 (= E33), Q34 (≠ K34), M38 (≠ V36), G41 (= G39), T42 (= T40), G47 (= G45), C48 (= C46), A99 (= A114), N126 (= N142), T127 (= T143), G128 (= G144), G291 (= G309), D292 (= D310), F299 (= F317), T300 (= T318), Y301 (≠ H319), S303 (≠ A321), F333 (= F350)
6kyyA Cu(ii) complex of hocl-induced flavoprotein disulfide reductase rcla from escherichia coli (see paper)
34% identity, 99% coverage: 6:458/458 of query aligns to 2:432/432 of 6kyyA
- active site: C39 (= C41), C44 (= C46), T47 (= T49), Y159 (= Y183), E163 (= E187), H417 (= H443), E422 (= E448)
- binding copper (ii) ion: C39 (= C41), C44 (= C46), H226 (≠ T249), H229 (≠ T252), T291 (= T318)
- binding flavin-adenine dinucleotide: F7 (≠ A11), G8 (= G12), E29 (= E33), Q30 (≠ K34), M34 (≠ V36), T38 (= T40), C39 (= C41), C44 (= C46), K48 (= K50), A95 (= A114), N117 (= N142), T118 (= T143), G119 (= G144), I160 (= I184), R243 (= R270), D283 (= D310), F290 (= F317), T291 (= T318), S294 (≠ A321)
8ajjA Crystal structure of the disulfide reductase mera from staphylococcus aureus (see paper)
35% identity, 99% coverage: 4:455/458 of query aligns to 2:437/442 of 8ajjA
- binding flavin-adenine dinucleotide: G10 (= G12), E31 (= E33), Q32 (≠ K34), M36 (≠ V36), G39 (= G39), T40 (= T40), C41 (= C41), C46 (= C46), K50 (= K50), A97 (= A114), N126 (= N142), T127 (= T143), G128 (= G144), I169 (= I184), N255 (≠ S273), G290 (= G309), D291 (= D310), Q297 (≠ P316), F298 (= F317), T299 (= T318), Y300 (≠ H319), S302 (≠ A321)
- binding histidine: D353 (≠ P371), Y354 (= Y372)
Sites not aligning to the query:
8ajkB Crystal structure of a c43s variant from the disulfide reductase mera from staphylococcus aureus (see paper)
34% identity, 99% coverage: 1:455/458 of query aligns to 2:440/447 of 8ajkB
- binding flavin-adenine dinucleotide: G11 (= G10), G13 (= G12), E34 (= E33), Q35 (≠ K34), M39 (≠ V36), G42 (= G39), T43 (= T40), G48 (= G45), C49 (= C46), K53 (= K50), K99 (≠ S113), A100 (= A114), N129 (= N142), T130 (= T143), G131 (= G144), G293 (= G309), D294 (= D310), Q300 (≠ P316), F301 (= F317), T302 (= T318), Y303 (≠ H319), S305 (≠ A321)
5x1yB Structure of mercuric reductase from lysinibacillus sphaericus (see paper)
31% identity, 98% coverage: 2:450/458 of query aligns to 2:446/454 of 5x1yB
- active site: A13 (≠ Q13), V37 (≠ I37), C41 (= C41), C46 (= C46), S49 (≠ T49), A74 (≠ H74), G75 (≠ Y75), Y178 (= Y183), E182 (= E187), A318 (≠ Y322), A437 (≠ I441), Y439 (≠ H443), E444 (= E448)
- binding flavin-adenine dinucleotide: I9 (≠ L9), G12 (= G12), I32 (= I32), E33 (= E33), R34 (≠ K34), G39 (= G39), T40 (= T40), C41 (= C41), G45 (= G45), C46 (= C46), K50 (= K50), A114 (= A114), T138 (= T143), G139 (= G144), Y178 (= Y183), R266 (= R270), G305 (= G309), D306 (= D310), F313 (= F317), V314 (≠ T318), A317 (= A321)
D9J041 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
31% identity, 98% coverage: 2:450/458 of query aligns to 83:527/546 of D9J041
- C122 (= C41) modified: Disulfide link with 127, Redox-active
- C127 (= C46) modified: Disulfide link with 122, Redox-active
P16171 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Bacillus cereus (see paper)
30% identity, 98% coverage: 3:450/458 of query aligns to 169:612/631 of P16171
- Y264 (≠ E98) mutation to F: 30-fold decrease in activity. 300-fold decrease in activity; when associated with F-605.
- Y605 (≠ H443) mutation to F: 10-fold decrease in activity. 300-fold decrease in activity; when associated with F-264.; mutation to H: 2-fold decrease in activity.
4jdrA Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase from escherichia coli (see paper)
30% identity, 97% coverage: 7:450/458 of query aligns to 9:451/471 of 4jdrA
- active site: P15 (≠ Q13), L40 (≠ I37), C44 (= C41), C49 (= C46), S52 (≠ T49), E77 (≠ H74), P78 (≠ Y75), I184 (≠ Y183), E188 (= E187), V324 (≠ Y322), H442 (≠ I441), H444 (= H443), E449 (= E448)
- binding flavin-adenine dinucleotide: G12 (= G10), G14 (= G12), P15 (≠ Q13), A16 (≠ S14), E35 (= E33), R36 (≠ K34), Y37 (vs. gap), V43 (≠ T40), C44 (= C41), G48 (= G45), C49 (= C46), K53 (= K50), L115 (≠ S113), G116 (≠ A114), A144 (≠ T143), G145 (= G144), I185 (= I184), G311 (= G309), D312 (= D310), M318 (≠ P316), L319 (≠ F317), A320 (≠ T318), H321 (= H319)
Sites not aligning to the query:
P0A9P0 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes; Glycine cleavage system L protein; EC 1.8.1.4 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 97% coverage: 7:450/458 of query aligns to 10:452/474 of P0A9P0
- K220 (= K218) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ebdA Dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase (see paper)
31% identity, 97% coverage: 5:448/458 of query aligns to 5:445/455 of 1ebdA
- active site: P13 (≠ Q13), L37 (≠ I37), C41 (= C41), C46 (= C46), S49 (≠ T49), N74 (≠ H74), V75 (≠ Y75), Y180 (= Y183), E184 (= E187), S320 (≠ Y322), H438 (≠ I441), H440 (= H443), E445 (= E448)
- binding flavin-adenine dinucleotide: G10 (= G10), G12 (= G12), P13 (≠ Q13), V32 (≠ I32), E33 (= E33), K34 (= K34), G39 (= G39), V40 (≠ T40), C41 (= C41), G45 (= G45), C46 (= C46), K50 (= K50), E112 (≠ S113), A113 (= A114), T141 (= T143), G142 (= G144), Y180 (= Y183), I181 (= I184), R268 (= R270), D308 (= D310), A314 (≠ P316), L315 (≠ F317), A316 (≠ T318)
P11959 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
31% identity, 97% coverage: 5:448/458 of query aligns to 11:451/470 of P11959
- 39:47 (vs. 33:41, 56% identical) binding
- K56 (= K50) binding
- D314 (= D310) binding
- A322 (≠ T318) binding
3urhB Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
31% identity, 98% coverage: 4:451/458 of query aligns to 1:453/465 of 3urhB
- active site: Y35 (≠ I37), C39 (= C41), C44 (= C46), S47 (≠ T49), V183 (≠ Y183), E187 (= E187), H443 (≠ I441), H445 (= H443), E450 (= E448)
- binding flavin-adenine dinucleotide: I6 (≠ L9), G7 (= G10), G9 (= G12), P10 (≠ Q13), G11 (≠ S14), E30 (= E33), K31 (= K34), G37 (= G39), T38 (= T40), C39 (= C41), G43 (= G45), C44 (= C46), K48 (= K50), T111 (≠ S113), G112 (≠ A114), A140 (≠ N142), T141 (= T143), G142 (= G144), I184 (= I184), R273 (= R270), G312 (= G309), D313 (= D310), M319 (≠ P316), L320 (≠ F317), A321 (≠ T318), H322 (= H319)
6uziC Crystal structure of dihydrolipoyl dehydrogenase from elizabethkingia anophelis nuhp1
30% identity, 98% coverage: 1:450/458 of query aligns to 4:455/470 of 6uziC
- active site: C45 (= C41), C50 (= C46), S53 (≠ T49), V187 (≠ Y183), E191 (= E187), H448 (= H443), E453 (= E448)
- binding flavin-adenine dinucleotide: I12 (≠ L9), G13 (= G10), G15 (= G12), P16 (≠ Q13), G17 (≠ S14), E36 (= E33), K37 (= K34), G43 (= G39), T44 (= T40), C45 (= C41), G49 (= G45), C50 (= C46), S53 (≠ T49), K54 (= K50), V117 (≠ S113), G118 (≠ A114), T147 (= T143), G148 (= G144), I188 (= I184), R276 (= R270), D316 (= D310), M322 (≠ P316), L323 (≠ F317), A324 (≠ T318)
- binding zinc ion: H448 (= H443), E453 (= E448)
P00392 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Pseudomonas aeruginosa (see 2 papers)
31% identity, 97% coverage: 8:450/458 of query aligns to 103:542/561 of P00392
- A110 (≠ G15) binding
- G130 (≠ R35) binding
- T135 (= T40) binding
- C136 (= C41) modified: Disulfide link with 141, Redox-active
- C141 (= C46) modified: Disulfide link with 136, Redox-active
- K145 (= K50) binding
- A211 (= A114) binding
- D403 (= D310) binding
- V411 (≠ T318) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 558 binding
- 559 binding
4k8dA Crystal structure of the c558(464)a/c559(465)a double mutant of tn501 mera in complex with NADPH and hg2+
31% identity, 97% coverage: 8:450/458 of query aligns to 8:447/466 of 4k8dA
- active site: G13 (≠ Q13), I37 (= I37), C41 (= C41), C46 (= C46), S49 (≠ T49), V75 (≠ H74), P76 (≠ Y75), V185 (≠ Y183), E189 (= E187), A320 (≠ Y322), F438 (≠ I441), Y440 (≠ H443), E445 (= E448)
- binding flavin-adenine dinucleotide: I9 (≠ L9), G10 (= G10), G12 (= G12), A14 (≠ S14), E33 (= E33), R34 (≠ K34), G39 (= G39), T40 (= T40), C41 (= C41), G45 (= G45), C46 (= C46), K50 (= K50), E115 (≠ S113), A116 (= A114), T145 (= T143), G146 (= G144), R268 (= R270), G307 (= G309), D308 (= D310), F315 (= F317), V316 (≠ T318), Y317 (≠ H319)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S183 (≠ G181), S184 (≠ G182), V185 (≠ Y183), V186 (≠ I184), E189 (= E187), R206 (= R204), N207 (≠ E206), R212 (≠ K211), T266 (= T268), G267 (= G269), Q314 (≠ P316), F315 (= F317), V345 (≠ C348)
Sites not aligning to the query:
3o0hB Crystal structure of glutathione reductase from bartonella henselae
30% identity, 98% coverage: 3:450/458 of query aligns to 3:442/459 of 3o0hB
- active site: S13 (≠ Q13), I37 (= I37), C41 (= C41), C46 (= C46), K49 (≠ T49), D74 (vs. gap), P75 (= P73), Y177 (= Y183), E181 (= E187), I314 (≠ Y322), A433 (≠ I441), H435 (= H443), E440 (= E448)
- binding flavin-adenine dinucleotide: I9 (≠ L9), G10 (= G10), G12 (= G12), S13 (≠ Q13), G14 (≠ S14), A32 (≠ I32), E33 (= E33), E34 (≠ K34), T40 (= T40), C41 (= C41), G45 (= G45), C46 (= C46), K49 (≠ T49), R112 (≠ S113), A113 (= A114), T139 (= T143), G140 (= G144), Y177 (= Y183), R262 (= R270), N265 (≠ S273), G301 (= G309), D302 (= D310), Q308 (≠ P316), L309 (≠ F317), T310 (= T318)
Sites not aligning to the query:
2eq7A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8 with psbdo
30% identity, 98% coverage: 4:452/458 of query aligns to 2:443/452 of 2eq7A
- active site: P11 (≠ Q13), L36 (≠ I37), C40 (= C41), C45 (= C46), S48 (≠ T49), G72 (≠ H74), V73 (≠ Y75), V177 (≠ Y183), E181 (= E187), S314 (≠ Y322), H432 (≠ I441), H434 (= H443), E439 (= E448)
- binding flavin-adenine dinucleotide: G10 (= G12), P11 (≠ Q13), G12 (≠ S14), E31 (= E33), K32 (= K34), G38 (= G39), T39 (= T40), C40 (= C41), R42 (≠ N43), G44 (= G45), C45 (= C46), K49 (= K50), T110 (≠ S113), A111 (= A114), T137 (= T143), G138 (= G144), S157 (= S163), I178 (= I184), R262 (= R270), Y265 (≠ S273), D302 (= D310), M308 (≠ P316), L309 (≠ F317), A310 (≠ T318), H311 (= H319), Y341 (≠ F350)
- binding nicotinamide-adenine-dinucleotide: W146 (≠ I152), G174 (= G180), G176 (= G182), V177 (≠ Y183), I178 (= I184), E197 (≠ D203), Y198 (≠ R204), V231 (= V237), V260 (≠ T268), G261 (= G269), R262 (= R270), M308 (≠ P316), L309 (≠ F317), V339 (≠ C348)
2yquB Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
30% identity, 98% coverage: 4:452/458 of query aligns to 2:443/455 of 2yquB
- active site: P11 (≠ Q13), L36 (≠ I37), C40 (= C41), C45 (= C46), S48 (≠ T49), G72 (≠ H74), V73 (≠ Y75), V177 (≠ Y183), E181 (= E187), S314 (≠ Y322), H432 (≠ I441), H434 (= H443), E439 (= E448)
- binding carbonate ion: A310 (≠ T318), S314 (≠ Y322), S423 (≠ T432), D426 (≠ T435)
- binding flavin-adenine dinucleotide: G8 (= G10), G10 (= G12), P11 (≠ Q13), G12 (≠ S14), E31 (= E33), K32 (= K34), G38 (= G39), T39 (= T40), C40 (= C41), R42 (≠ N43), G44 (= G45), C45 (= C46), K49 (= K50), T110 (≠ S113), A111 (= A114), T137 (= T143), G138 (= G144), I178 (= I184), Y265 (≠ S273), G301 (= G309), D302 (= D310), M308 (≠ P316), L309 (≠ F317), A310 (≠ T318), H311 (= H319)
2yquA Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
30% identity, 98% coverage: 4:452/458 of query aligns to 2:443/455 of 2yquA
- active site: P11 (≠ Q13), L36 (≠ I37), C40 (= C41), C45 (= C46), S48 (≠ T49), G72 (≠ H74), V73 (≠ Y75), V177 (≠ Y183), E181 (= E187), S314 (≠ Y322), H432 (≠ I441), H434 (= H443), E439 (= E448)
- binding flavin-adenine dinucleotide: G8 (= G10), G10 (= G12), P11 (≠ Q13), G12 (≠ S14), E31 (= E33), K32 (= K34), G38 (= G39), T39 (= T40), C40 (= C41), R42 (≠ N43), G44 (= G45), C45 (= C46), K49 (= K50), T110 (≠ S113), A111 (= A114), T137 (= T143), G138 (= G144), S157 (= S163), I178 (= I184), Y265 (≠ S273), G301 (= G309), D302 (= D310), M308 (≠ P316), L309 (≠ F317), A310 (≠ T318)
4k7zA Crystal structure of the c136(42)a/c141(47)a double mutant of tn501 mera in complex with NADP and hg2+
31% identity, 97% coverage: 8:450/458 of query aligns to 9:448/467 of 4k7zA
- active site: G14 (≠ Q13), I38 (= I37), A42 (≠ C41), A47 (≠ C46), S50 (≠ T49), V76 (≠ H74), P77 (≠ Y75), V186 (≠ Y183), E190 (= E187), A321 (≠ Y322), F439 (≠ I441), Y441 (≠ H443), E446 (= E448)
- binding flavin-adenine dinucleotide: I10 (≠ L9), G11 (= G10), G13 (= G12), A15 (≠ S14), E34 (= E33), R35 (≠ K34), G40 (= G39), T41 (= T40), A42 (≠ C41), G46 (= G45), A47 (≠ C46), K51 (= K50), E116 (≠ S113), A117 (= A114), T146 (= T143), G147 (= G144), R269 (= R270), G308 (= G309), D309 (= D310), Q315 (≠ P316), F316 (= F317), V317 (≠ T318), Y318 (≠ H319)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S184 (≠ G181), S185 (≠ G182), V186 (≠ Y183), V187 (≠ I184), E190 (= E187), R207 (= R204), N208 (≠ E206), R213 (≠ K211), T267 (= T268), G268 (= G269), R269 (= R270), Q315 (≠ P316), F316 (= F317), V346 (≠ C348)
Sites not aligning to the query:
Query Sequence
>Echvi_0722 Echvi_0722 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes
MENYDAIVLGAGQSGMPLAKKISKLGLSVALIEKRVIGGTCINDGCSPTKTMVSSARVAH
IVSRAADFGTILPHYRIDQRIVKKRKDHIVELFRGGAEKSLRKNESIDILMGSAAFKDSR
TIQITSDTGEISFISGTKIFINTGSEPRIPEIEGLADTPYLTSTTIMELEETPEHLLIMG
GGYIGLEFAQMFSRFGSKVTIIDRAERLVHKEDEDVCKEISQIFSEEGIDTLFNAEVRKV
SYQDGFKLTTETPKGLLDIKGSHLLVATGRIPSSAHLGLENTRVKLTDKGFIQTDDFLQT
SEKHIYALGDVAGSAPFTHIAYHDAHIAFQHAFKENAVSKHERLVPYCVFIDPQLGRIGL
NEQEAQAKGIPYKTGKFLMKHAGRTLEVDETRGFFKVQVDPESKKILGATILSLDGGEIL
ATLQMAMVGGVTYDTIATLPIAHPTLAESLNNLMGQIE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory