Comparing Echvi_0870 Echvi_0870 Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
5abtA S.Enterica hisa mutant d7n, g102a, v106m, d176a
32% identity, 94% coverage: 4:236/248 of query aligns to 2:237/246 of 5abtA
5ab3A S.Enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a (see paper)
31% identity, 94% coverage: 4:236/248 of query aligns to 2:234/241 of 5ab3A
5dn1A Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor (see paper)
28% identity, 95% coverage: 2:236/248 of query aligns to 4:234/240 of 5dn1A
P16250 Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16; EC 5.3.1.24 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
28% identity, 95% coverage: 2:236/248 of query aligns to 4:234/240 of P16250
4tx9A Crystal structure of hisap from streptomyces sviceus with degraded profar (see paper)
30% identity, 97% coverage: 2:242/248 of query aligns to 9:245/246 of 4tx9A
2y88A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar (see paper)
27% identity, 93% coverage: 4:233/248 of query aligns to 5:234/244 of 2y88A
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
27% identity, 93% coverage: 4:233/248 of query aligns to 5:234/244 of 3zs4A
2y85A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp (see paper)
26% identity, 93% coverage: 4:233/248 of query aligns to 5:225/234 of 2y85A
Q9X0C7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
22% identity, 96% coverage: 4:240/248 of query aligns to 3:239/241 of Q9X0C7
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
23% identity, 84% coverage: 2:210/248 of query aligns to 5:213/253 of 1h5yB
Sites not aligning to the query:
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
20% identity, 92% coverage: 15:241/248 of query aligns to 9:232/244 of 3zr4E
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
20% identity, 82% coverage: 8:210/248 of query aligns to 7:210/253 of 1gpwC
Sites not aligning to the query:
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
20% identity, 73% coverage: 30:210/248 of query aligns to 29:210/253 of Q9X0C6
Sites not aligning to the query:
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
20% identity, 73% coverage: 30:210/248 of query aligns to 29:210/252 of 7ac8A
Sites not aligning to the query:
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
20% identity, 92% coverage: 15:241/248 of query aligns to 9:227/237 of 2wjzE
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
20% identity, 83% coverage: 4:210/248 of query aligns to 6:210/250 of 7qc8A
>Echvi_0870 Echvi_0870 Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase
MFEIIPSIWIINGKCVRLKKGDFTTEQVISDNPLEIAQEFENCGIERIHLVDLDGARRGS
PKNYHILHTISAYTSLIVDFTGGVGTDGDIIKVFEHGAKTITAATVAANSPEKFSQWLIS
YGREKINMAADTDPKDHLIKIKGWQKNTDIHLYDQISYFYDRGLKYLKCSDITREGVMEG
PNFKLYEEIIARFPNLHLVASGGVRNVDDFKRLKELGLRGVVFGKAYYSGNITAEELKTF
VASCKAPI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory