SitesBLAST
Comparing Echvi_0893 FitnessBrowser__Cola:Echvi_0893 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3of4C Crystal structure of a fmn/fad- and NAD(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution
34% identity, 95% coverage: 4:207/215 of query aligns to 3:206/208 of 3of4C
3of4A Crystal structure of a fmn/fad- and NAD(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution
34% identity, 95% coverage: 4:207/215 of query aligns to 3:206/208 of 3of4A
- active site: A14 (≠ K14), K68 (≠ Q68), E156 (= E156)
- binding flavin mononucleotide: R10 (= R10), Y11 (= Y11), A12 (= A12), A37 (≠ P37), S38 (= S38), S39 (= S39), G41 (= G41), Q66 (= Q66), K68 (≠ Q68), C153 (≠ T153), P154 (= P154), M155 (= M155), E156 (= E156), G157 (= G157), R198 (= R199)
6czpA 2.2 angstrom resolution crystal structure oxygen-insensitive NAD(p)h- dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn
33% identity, 93% coverage: 1:199/215 of query aligns to 3:209/219 of 6czpA
- active site: K16 (= K14), K76 (≠ Q68), E167 (= E156)
- binding flavin mononucleotide: R12 (= R10), Y13 (= Y11), S14 (≠ A12), K16 (= K14), S41 (= S38), S42 (= S39), N44 (≠ G41), N73 (≠ D65), K76 (≠ Q68), P165 (= P154), I166 (≠ M155), E167 (= E156), G168 (= G157), K207 (= K197), R209 (= R199)
7uwtB Structure of oxygen-insensitive NAD(p)h-dependent nitroreductase nfsb_vv f70a/f108y (ntr 2.0) in complex with fmn at 1.85 angstroms resolution (see paper)
33% identity, 93% coverage: 1:199/215 of query aligns to 1:207/217 of 7uwtB
- binding flavin mononucleotide: R10 (= R10), Y11 (= Y11), S12 (≠ A12), K14 (= K14), N71 (≠ D65), K74 (≠ Q68), P163 (= P154), I164 (≠ M155), E165 (= E156), G166 (= G157), K205 (= K197), R207 (= R199)
- binding polyethylene glycol: M1 (= M1), E54 (≠ P53), L76 (≠ T70), D77 (= D71), E158 (≠ K149), D197 (≠ N189)
1v5zA Binding of coumarins to NAD(p)h:fmn oxidoreductase
30% identity, 95% coverage: 3:206/215 of query aligns to 4:214/217 of 1v5zA
- active site: K15 (= K14), H75 (≠ Q68), E164 (= E156)
- binding (2e)-3-(2-hydroxyphenyl)acrylic acid: S41 (= S39), I42 (≠ S40), F123 (≠ Y118), E164 (= E156), G165 (= G157)
- binding flavin mononucleotide: R11 (= R10), Y12 (= Y11), T13 (≠ A12), K15 (= K14), A39 (≠ P37), S40 (= S38), S41 (= S39), N43 (≠ G41), N72 (≠ D65), T162 (≠ P154), M163 (= M155), E164 (= E156), K205 (= K197), R207 (= R199)
1v5yA Binding of coumarins to NAD(p)h:fmn oxidoreductase
30% identity, 95% coverage: 3:206/215 of query aligns to 4:214/217 of 1v5yA
- active site: K15 (= K14), H75 (≠ Q68), E164 (= E156)
- binding 4-hydroxy-2h-chromen-2-one: S41 (= S39), I42 (≠ S40), F123 (≠ Y118)
- binding flavin mononucleotide: R11 (= R10), Y12 (= Y11), T13 (≠ A12), K15 (= K14), A39 (≠ P37), S40 (= S38), S41 (= S39), N72 (≠ D65), T162 (≠ P154), M163 (= M155), E164 (= E156), G165 (= G157), K205 (= K197), R207 (= R199)
7jh4B Crystal structure of NAD(p)h-flavin oxidoreductase (nfor) from s. Aureus complexed with reduced fmn and NAD+ (see paper)
29% identity, 87% coverage: 2:188/215 of query aligns to 7:202/223 of 7jh4B
- active site: K19 (= K14), Q75 (= Q68), E166 (= E156)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: R15 (= R10), H16 (≠ Y11), A17 (= A12), K19 (= K14), P43 (= P37), S44 (= S38), S45 (= S39), G47 (= G41), G71 (≠ D65), Q75 (= Q68), Q143 (= Q133), P164 (= P154), M165 (= M155), E166 (= E156), G167 (= G157)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ S40), F123 (≠ Y110)
Sites not aligning to the query:
7jh4A Crystal structure of NAD(p)h-flavin oxidoreductase (nfor) from s. Aureus complexed with reduced fmn and NAD+ (see paper)
29% identity, 87% coverage: 2:188/215 of query aligns to 7:202/223 of 7jh4A
- active site: K19 (= K14), Q75 (= Q68), E166 (= E156)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: R15 (= R10), H16 (≠ Y11), A17 (= A12), K19 (= K14), P43 (= P37), S44 (= S38), S45 (= S39), G47 (= G41), G71 (≠ D65), Q143 (= Q133), P164 (= P154), M165 (= M155), E166 (= E156), G167 (= G157)
Sites not aligning to the query:
8q5gA Crystal structure of nitroreductase from bacillus tequilensis with covalent fmn (see paper)
34% identity, 78% coverage: 18:185/215 of query aligns to 9:187/206 of 8q5gA
Sites not aligning to the query:
6wt2A Crystal structure of putative NAD(p)h-flavin oxidoreductase from neisseria meningitidis
31% identity, 88% coverage: 18:207/215 of query aligns to 25:219/221 of 6wt2A
- active site: A76 (≠ I69), E168 (= E156)
- binding flavin mononucleotide: P44 (= P37), S45 (= S38), S46 (= S39), G72 (≠ D65), R106 (= R100), Q145 (= Q133), C165 (≠ T153), P166 (= P154), V167 (≠ M155), E168 (= E156), G169 (= G157), K209 (= K197), R211 (= R199)
- binding nicotinic acid: V47 (≠ S40), R106 (= R100), F124 (≠ M117)
Sites not aligning to the query:
2hayD The crystal structure of the putative NAD(p)h-flavin oxidoreductase from streptococcus pyogenes m1 gas
32% identity, 93% coverage: 7:206/215 of query aligns to 14:218/222 of 2hayD
- active site: Q76 (= Q68), E168 (= E156)
- binding flavin mononucleotide: R17 (= R10), T18 (≠ Y11), A19 (= A12), P44 (= P37), S45 (= S38), S46 (= S39), G72 (≠ D65), Q145 (= Q133), C165 (≠ T153), P166 (= P154), I167 (≠ M155), E168 (= E156), G169 (= G157), R211 (= R199)
7s14B Crystal structure of putative NAD(p)h-flavin oxidoreductase from haemophilus influenzae 86-028np
28% identity, 87% coverage: 3:188/215 of query aligns to 12:206/223 of 7s14B
- binding flavin mononucleotide: R19 (= R10), S20 (≠ Y11), S21 (≠ A12), R23 (≠ K14), P47 (= P37), S48 (= S38), S49 (= S39), G75 (≠ D65), C167 (≠ T153), P168 (= P154), I169 (≠ M155), E170 (= E156), G171 (= G157)
Sites not aligning to the query:
7s14A Crystal structure of putative NAD(p)h-flavin oxidoreductase from haemophilus influenzae 86-028np
28% identity, 87% coverage: 3:188/215 of query aligns to 8:202/219 of 7s14A
- binding calcium ion: E10 (= E5)
- binding flavin mononucleotide: R15 (= R10), S16 (≠ Y11), S17 (≠ A12), R19 (≠ K14), P43 (= P37), S44 (= S38), S45 (= S39), G71 (≠ D65), C163 (≠ T153), P164 (= P154), I165 (≠ M155), E166 (= E156), G167 (= G157)
Sites not aligning to the query:
7t33A The structure of haemophilus influenzae rd kw20 nitroreductase complexed with nicotinic acid (see paper)
28% identity, 87% coverage: 3:188/215 of query aligns to 8:202/219 of 7t33A
- binding flavin mononucleotide: R15 (= R10), S17 (≠ A12), R19 (≠ K14), P43 (= P37), S44 (= S38), S45 (= S39), Q143 (= Q133), C163 (≠ T153), P164 (= P154), I165 (≠ M155), E166 (= E156), G167 (= G157)
- binding nicotinic acid: W70 (= W64), G167 (= G157)
Sites not aligning to the query:
7xwwA Crystal structure of ntr in complex with bn-xb
30% identity, 90% coverage: 10:203/215 of query aligns to 9:210/216 of 7xwwA
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (≠ A12), P37 (= P37), S38 (= S38), S39 (= S39), N41 (≠ G41), N70 (≠ D65), P162 (= P154), I163 (≠ M155), E164 (= E156), K204 (= K197), R206 (= R199)
- binding 2,2-bis(fluoranyl)-4,6,10,12-tetramethyl-8-[1-[(4-nitrophenyl)methyl]pyridin-1-ium-4-yl]-3-aza-1-azonia-2-boranuidatricyclo[7.3.0.0^{3,7}]dodeca-1(12),4,6,8,10-pentaene: T40 (≠ S40), E101 (≠ T96), R106 (≠ G101), F107 (≠ L102), N116 (≠ R111)
7x32A Crystal structure of e. Coli nfsb in complex with berberine (see paper)
30% identity, 90% coverage: 10:203/215 of query aligns to 9:210/216 of 7x32A
- binding berberine: K13 (= K14), F69 (≠ W64)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (≠ A12), K13 (= K14), P37 (= P37), S38 (= S38), S39 (= S39), N41 (≠ G41), N70 (≠ D65), P162 (= P154), I163 (≠ M155), E164 (= E156), G165 (= G157), K204 (= K197), R206 (= R199)
1ylrA The structure of e.Coli nitroreductase with bound acetate, crystal form 1 (see paper)
30% identity, 90% coverage: 10:203/215 of query aligns to 9:210/216 of 1ylrA
- active site: K13 (= K14), K73 (≠ Q68), E164 (= E156)
- binding acetate ion: T40 (≠ S40), F123 (≠ Y118)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (≠ A12), K13 (= K14), P37 (= P37), S38 (= S38), S39 (= S39), N41 (≠ G41), N70 (≠ D65), P162 (= P154), I163 (≠ M155), E164 (= E156), G165 (= G157), K204 (= K197), R206 (= R199)
1ykiA The structure of e. Coli nitroreductase bound with the antibiotic nitrofurazone (see paper)
30% identity, 90% coverage: 10:203/215 of query aligns to 9:210/216 of 1ykiA
- active site: K13 (= K14), K73 (≠ Q68), E164 (= E156)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (≠ A12), K13 (= K14), P37 (= P37), S38 (= S38), S39 (= S39), N41 (≠ G41), N70 (≠ D65), P162 (= P154), I163 (≠ M155), E164 (= E156), G165 (= G157), K204 (= K197), R206 (= R199)
- binding nitrofurazone: T40 (≠ S40), Y67 (vs. gap), F69 (≠ W64), N70 (≠ D65), F123 (≠ Y118)
1oonA Nitroreductase from e-coli in complex with the dinitrobenzamide prodrug sn27217 (see paper)
30% identity, 90% coverage: 10:203/215 of query aligns to 9:210/216 of 1oonA
- active site: K13 (= K14), K73 (≠ Q68), E164 (= E156)
- binding 2,4-dinitro,5-[bis(2-bromoethyl)amino]-n-(2',3'-dioxopropyl)benzamide: T40 (≠ S40), E101 (≠ T96), N116 (≠ R111), F123 (≠ Y118)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (≠ A12), K13 (= K14), S38 (= S38), S39 (= S39), N41 (≠ G41), N70 (≠ D65), L144 (≠ I136), P162 (= P154), I163 (≠ M155), E164 (= E156), G165 (= G157), K204 (= K197), R206 (= R199)
1icrA The structure of escherichia coli nitroreductase complexed with nicotinic acid (see paper)
30% identity, 90% coverage: 10:203/215 of query aligns to 9:210/216 of 1icrA
- active site: K13 (= K14), K73 (≠ Q68), E164 (= E156)
- binding flavin mononucleotide: R9 (= R10), H10 (≠ Y11), S11 (≠ A12), K13 (= K14), P37 (= P37), S38 (= S38), S39 (= S39), N41 (≠ G41), N70 (≠ D65), K73 (≠ Q68), P162 (= P154), I163 (≠ M155), E164 (= E156), G165 (= G157), K204 (= K197), R206 (= R199)
- binding nicotinic acid: S39 (= S39), T40 (≠ S40), F123 (≠ Y118)
Query Sequence
>Echvi_0893 FitnessBrowser__Cola:Echvi_0893
MSLLENLEWRYATKKMNGKAVPQEKVDYILEAARLSPSSSGLQPYRVIVVTDPEIKEKMK
PIAWDQSQITDASHILVFAAWENYTEEKIKAVFKETLTARGLPLDKMDAYRERLWGMYSQ
LPEEWHAHHAAKQAYIAFGTAIAAAAEQKVDATPMEGFDPEGLDALLGLKELGLKSAVVL
PLGYRDEENDWLAGMKKFRTPKEEFIITSDELVEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory