Comparing Echvi_0942 FitnessBrowser__Cola:Echvi_0942 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
35% identity, 53% coverage: 102:232/246 of query aligns to 57:183/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
35% identity, 53% coverage: 102:232/246 of query aligns to 47:173/176 of 3ectA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
35% identity, 53% coverage: 102:232/246 of query aligns to 54:180/183 of 3nz2C
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
47% identity, 37% coverage: 142:231/246 of query aligns to 95:182/186 of 4isxA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
36% identity, 48% coverage: 114:231/246 of query aligns to 67:182/190 of 5u2kA
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
39% identity, 37% coverage: 142:232/246 of query aligns to 97:185/188 of 3igjC
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
37% identity, 48% coverage: 122:238/246 of query aligns to 61:172/204 of 1mrlA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
44% identity, 32% coverage: 156:234/246 of query aligns to 89:163/206 of 6u9cA
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
37% identity, 48% coverage: 122:238/246 of query aligns to 61:172/203 of 3dhoA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
44% identity, 32% coverage: 156:234/246 of query aligns to 92:166/210 of 6pubA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
37% identity, 48% coverage: 122:238/246 of query aligns to 61:172/209 of P50870
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
37% identity, 48% coverage: 122:238/246 of query aligns to 61:172/206 of 1khrA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
37% identity, 48% coverage: 122:238/246 of query aligns to 61:172/205 of 1kk4A
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
52% identity, 22% coverage: 181:234/246 of query aligns to 114:167/211 of 4hurA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
52% identity, 22% coverage: 181:234/246 of query aligns to 114:167/212 of 4husA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
52% identity, 22% coverage: 181:234/246 of query aligns to 114:167/207 of 6x3cA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
52% identity, 22% coverage: 181:234/246 of query aligns to 114:167/206 of 6x3jA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
52% identity, 22% coverage: 181:234/246 of query aligns to 114:167/203 of 6x3cE
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
32% identity, 53% coverage: 101:231/246 of query aligns to 56:182/200 of 1krrA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 53% coverage: 101:231/246 of query aligns to 57:183/203 of P07464
Sites not aligning to the query:
>Echvi_0942 FitnessBrowser__Cola:Echvi_0942
MANFIQRTLTNLTGIDLSDRFDENWDSLSTLGVLWRMSGWFIRGCFRRLWFKSSEGMLLI
GKRVTIRQARYLSVGKNFIAQDNCEINCLSQKGIVFGDKVTVGSYAIIRPTNLYGGEAGV
GLKVGNNSSIGPYAYIGCSGYIEIGDNVMMSPRVSIYSENHNFDDTESPMIEQGVTRSFA
KIEDDCWIASNSIILAGVTVGKGSVVAAGSVVTKDVPPYSIVGGNPAKLLKTRFEQKSAG
KTANDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory