Comparing Echvi_1044 FitnessBrowser__Cola:Echvi_1044 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
23% identity, 98% coverage: 10:564/566 of query aligns to 2:538/540 of 8jejA
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
23% identity, 98% coverage: 13:564/566 of query aligns to 2:535/537 of 7w2jD
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
23% identity, 78% coverage: 117:559/566 of query aligns to 91:525/531 of 8grjB
Sites not aligning to the query:
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
25% identity, 25% coverage: 428:566/566 of query aligns to 432:570/570 of 4migA
Sites not aligning to the query:
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
25% identity, 25% coverage: 428:566/566 of query aligns to 443:581/581 of 4mifB
Sites not aligning to the query:
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
25% identity, 25% coverage: 428:566/566 of query aligns to 438:576/576 of 4mihA
Sites not aligning to the query:
>Echvi_1044 FitnessBrowser__Cola:Echvi_1044
MANLNIKGKEENSFGAIVIGSGMSGGFAAKELCDKGVKTLVLERGRSVVHNKDYPTTNMM
PWEFEHRGQIPEDIQRENPVVSRCYAFREDAAHFFVKDQEHPYIQEKPFDWIRGYQTGGK
SLLWARQVQRWSDHDFEGPARDGFAVDWPIRYKDLAPWYSYVEKFVGVAGFHDGIPHLPD
GEFLPGIELTAAEEYFKSVVEEKYPGRNVISGRYAHITGNAEYYAKQGRGICQHRTICQR
GCPFGGYFSSNSASLPWAQRTGNLTLKNHAVVHSIIYDDTQQKATGVRVIDANTKEVTEY
YAPIIFVNASALNTNLILLNSTSKRFPHGLGNDNGLMGKFIAFHNYRGGVSGEYEGLKSF
TTEGKRPTSGYMPRFRNVDKQETKFLRGYAAGIHGTRSKDVDYSGTGADLVKNIMNPSYG
PWRIGSHMMGETIPKESNYVALDTAQKDEWDMPQLKVNVDYDQNDLDMIKDYREQLAEMF
DAAGFKNIRTWDDERRPGLDIHEMGGVRMGHDPKTSLLNKHHQLHACPNVYVTDGACMTS
TSTQNPSLTYMVFAARAVDHALKNQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory