Comparing Echvi_1069 FitnessBrowser__Cola:Echvi_1069 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
30% identity, 38% coverage: 5:306/801 of query aligns to 27:311/314 of P00348
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
31% identity, 38% coverage: 2:306/801 of query aligns to 1:288/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
30% identity, 38% coverage: 2:306/801 of query aligns to 24:311/314 of Q16836
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
32% identity, 38% coverage: 2:306/801 of query aligns to 1:288/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
32% identity, 38% coverage: 2:306/801 of query aligns to 1:288/293 of 1f12A
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 38% coverage: 1:306/801 of query aligns to 1:284/286 of P9WNP7
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
27% identity, 38% coverage: 6:306/801 of query aligns to 1:277/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
27% identity, 38% coverage: 5:306/801 of query aligns to 1:278/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
27% identity, 38% coverage: 5:306/801 of query aligns to 1:278/280 of 4kuhA
4om8A Crystal structure of 5-formly-3-hydroxy-2-methylpyridine 4-carboxylic acid (fhmpc) 5-dehydrogenase, an NAD+ dependent dismutase. (see paper)
29% identity, 38% coverage: 5:306/801 of query aligns to 2:280/309 of 4om8A
Q988C8 5-formyl-3-hydroxy-2-methylpyridine 4-carboxylate 5-dehydrogenase; FHMPC dehydrogenase; EC 1.2.1.100 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see 2 papers)
29% identity, 38% coverage: 5:306/801 of query aligns to 2:280/309 of Q988C8
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
26% identity, 38% coverage: 3:306/801 of query aligns to 289:564/692 of 6iunB
Sites not aligning to the query:
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
30% identity, 28% coverage: 100:327/801 of query aligns to 393:610/715 of 1wdlA
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
30% identity, 28% coverage: 100:327/801 of query aligns to 393:610/715 of P28793
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
30% identity, 27% coverage: 100:315/801 of query aligns to 393:599/707 of 1wdmA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
31% identity, 26% coverage: 2:213/801 of query aligns to 313:505/711 of 7o4uA
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
31% identity, 26% coverage: 2:213/801 of query aligns to 333:525/731 of 4b3iA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
31% identity, 26% coverage: 2:213/801 of query aligns to 331:523/728 of 8oqrA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
31% identity, 26% coverage: 2:213/801 of query aligns to 331:523/729 of 8pf8A
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
31% identity, 26% coverage: 2:213/801 of query aligns to 329:521/726 of 8oqvA
Sites not aligning to the query:
>Echvi_1069 FitnessBrowser__Cola:Echvi_1069
MKRAIQKVAILGSGVMGSRIACHFANIGVKVLLLDILPKEPNEAESKKGLSLEDKAVRNR
LVNEALEKTLKSKPSPIYDRAFADRIQTGNFDDDLPKIKDYDWVIEVVVERLDIKQSLYE
KVEQHRKPGTLITSNTSGIPMQMLCEGRSDDFQANFCGTHFFNPPRYLRLLEIIPGPKTD
PAIIDFLMDYGDRHLGKETVLCKDTPAFIANRIGVYAMMSSMHIIESMKMGVSEVDKLTG
TVIGRAKSATFRTMDVVGLDTMVNVANNLSKALQNDESKDKFKLPKTVAYLSEKKWLGDK
TGQGFFHMIRHKDGSKELKEIDLQTHEYKPAEKPKFKALEASKEINDLKERIKFLVNFDD
EAGAFYRATFYDLFRYCSFRIPEISDELYRIDQAVCAGFGWEYGPFENWDILGLKDTIKK
MEEADQRPAEWIYEMLDAGNEHFYRVEDGRRQYYDIPSKSYKDIPGQQEFILLDTLKAAN
KKIWGNAGATIYDMGDEVIGLEFHTKMNSLGQEVIEGINTAITMAEKDYKGLVIGNEGAN
FSAGANLAMLFMFAGDQEFDEINLMIAQFQKTMMRVRYSSVPVVVAPHNMALGGGCEMSL
HADAVQAHAELYMGLVEFGVGLIPAGGGTKEMILRFSNAIHSGDVEVNRLQEYFMNIATA
KVSTSAEEARGLGYLQAKDDITLNRKRQFAEAKAKVIELFDEGYTQPVQQTNIKVLGKTS
LALFEAGITGMRYGAYISEHDAKIARKLAWVMSGGDLSQANEVSEQYLLELEREAFLSLT
GEQKTLERIQSILFKGKPLRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory