Comparing Echvi_1145 FitnessBrowser__Cola:Echvi_1145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
36% identity, 99% coverage: 3:245/246 of query aligns to 2:247/269 of Q5HNV1
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
34% identity, 99% coverage: 3:245/246 of query aligns to 2:238/258 of 3dooA
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
36% identity, 99% coverage: 4:246/246 of query aligns to 9:251/267 of 2hk9B
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
36% identity, 99% coverage: 4:246/246 of query aligns to 9:251/269 of 2hk9A
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
36% identity, 99% coverage: 4:246/246 of query aligns to 9:251/269 of O67049
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 99% coverage: 2:245/246 of query aligns to 7:262/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
31% identity, 99% coverage: 2:245/246 of query aligns to 12:267/287 of 1nvtB
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
31% identity, 99% coverage: 2:245/246 of query aligns to 12:267/287 of 1nvtA
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
30% identity, 100% coverage: 1:246/246 of query aligns to 1:244/262 of 2cy0A
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
30% identity, 100% coverage: 1:246/246 of query aligns to 1:244/263 of 2ev9B
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 100% coverage: 1:246/246 of query aligns to 1:244/263 of Q5SJF8
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
29% identity, 99% coverage: 4:246/246 of query aligns to 16:277/291 of 3tozA
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
29% identity, 99% coverage: 4:246/246 of query aligns to 13:274/288 of 3tnlA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
29% identity, 99% coverage: 4:246/246 of query aligns to 16:277/291 of Q8Y9N5
P44774 Shikimate dehydrogenase-like protein HI_0607; SDH-L; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
31% identity, 78% coverage: 54:246/246 of query aligns to 56:251/271 of P44774
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
30% identity, 100% coverage: 2:246/246 of query aligns to 235:475/500 of 2o7sA
Sites not aligning to the query:
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
29% identity, 99% coverage: 4:246/246 of query aligns to 237:476/501 of 2o7qA
Sites not aligning to the query:
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
29% identity, 100% coverage: 1:246/246 of query aligns to 1:253/271 of 1nytA
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
29% identity, 100% coverage: 1:246/246 of query aligns to 1:253/272 of P15770
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
28% identity, 99% coverage: 4:246/246 of query aligns to 4:265/280 of 1o9bA
>Echvi_1145 FitnessBrowser__Cola:Echvi_1145
MRKFGLIGYPLKHSFSGKYFAEKFDREGIQDCQYDLYEIDAISKFPELIKNNPGLEGINV
TIPYKEQVIPYLDELEPGCEAIGAVNCIKIKENKLIGYNTDYIGFKESLDAWLEGQRPKA
LILGTGGASKAVKQALEALEMPYLMVSRNANGQKGRITYDDLIKNEQYLQEYFLIVNTTP
LGTFPNTEEMPEIPVSQIGREHKVYDLVYNPEKTFLMRSLEARGAVVKNGLEMLQLQAEA
AWKIWN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory