SitesBLAST
Comparing Echvi_1176 FitnessBrowser__Cola:Echvi_1176 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q9X015 Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG; NTP-PPase; EC 3.6.1.1; EC 3.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 94% coverage: 14:264/266 of query aligns to 8:250/255 of Q9X015
- E41 (= E45) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-42.
- E42 (= E46) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity; when associated with Q-41.
- E45 (= E49) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- E61 (= E65) mutation to Q: Reduces the NTPase activity to 10% of the wild-type activity.
- R97 (= R101) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-98.
- R98 (= R102) mutation to A: Reduces the NTPase activity to 10% of the wild-type activity; when associated with A-97.
- K118 (= K126) mutation to E: Reduces the NTPase activity to 10% of the wild-type activity.
- E173 (= E179) mutation to A: Has little effects on the NTPase activity.
- E176 (= E182) mutation to A: Has little effects on the NTPase activity.
- E-----E 185:186 (≠ RERATGE 194:200) mutation to AA: Has little effects on the NTPase activity.
P0AEY3 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Escherichia coli (strain K12) (see paper)
38% identity, 96% coverage: 11:266/266 of query aligns to 1:259/263 of P0AEY3
- R95 (= R102) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K119 (= K126) mutation to A: Does not affect the nucleotide pyrophosphohydrolysis activity.
- K168 (≠ Q168) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KVYEE 168:172 (≠ QVWEK 168:172) binding
- E171 (= E171) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E172 (≠ K172) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- E175 (= E175) binding ; mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- K189 (≠ R196) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- KLEE 189:192 (≠ RATG 196:199) binding
- E192 (≠ G199) mutation to A: Does not affect nucleotide pyrophosphohydrolysis activity.
- E193 (= E200) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- D196 (= D203) binding ; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K222 (= K229) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- KFERR 222:226 (≠ KFIYR 229:233) binding
- R226 (= R233) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- W253 (= W260) binding ; mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
- K257 (= K264) mutation to A: Loss of pyrophosphohydrolysis activity against both ATP and dTTP.
3crcA Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
35% identity, 95% coverage: 14:266/266 of query aligns to 3:224/225 of 3crcA
3crcB Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
32% identity, 95% coverage: 14:266/266 of query aligns to 3:218/220 of 3crcB
P96379 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 58% coverage: 8:161/266 of query aligns to 81:235/325 of P96379
- A219 (= A145) mutation to E: Pyrophosphohydrolase activity is reduced 20-fold. It affects the magnesium binding and the protein structure.
A0R3C4 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 55% coverage: 18:164/266 of query aligns to 91:241/324 of A0R3C4
- A222 (= A145) mutation to E: Pyrophosphohydrolase activity is reduced 30-fold.
7yh5B Mazg(mycobacterium tuberculosis) (see paper)
39% identity, 36% coverage: 8:102/266 of query aligns to 81:177/177 of 7yh5B
2yxhA Crystal structure of mazg-related protein from thermotoga maritima
28% identity, 40% coverage: 14:119/266 of query aligns to 2:107/114 of 2yxhA
Query Sequence
>Echvi_1176 FitnessBrowser__Cola:Echvi_1176
MSKISSRSQQLEAFDRLLTIMDELREQCPWDRKQTIESLRHLTIEETFELSDAILDADLE
EVKKELGDILLHIVFYAKIGEEKGAFDIATVIESLCEKLIRRHPHIYGDTEANDDEAVKQ
NWEKIKLQEKGNKSVLGGVPRSLPALIKAMRIQEKARGVGFDWEDKAQVWEKVEEEMQEF
KEAFDVTAPEDIDRERATGEFGDVLFSLINYARFVDINPEEALEKTNRKFIYRFQYLEEA
AKKAGKNLGDMTLNEMDIFWNEAKKH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory