SitesBLAST
Comparing Echvi_1189 FitnessBrowser__Cola:Echvi_1189 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9GZT4 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Homo sapiens (Human) (see 4 papers)
46% identity, 95% coverage: 12:314/319 of query aligns to 11:320/340 of Q9GZT4
- E13 (≠ K14) binding Mg(2+)
- S31 (≠ C32) binding ATP
- S32 (≠ E33) binding ATP
- I33 (≠ A34) binding ATP
- K51 (= K52) binding ATP
- T52 (≠ V53) binding ATP
- K56 (= K57) modified: N6-(pyridoxal phosphate)lysine
- P69 (= P70) binding Ca(2+)
- T81 (= T79) binding Ca(2+)
- N86 (= N84) binding pyridoxal 5'-phosphate
- Q89 (≠ A87) binding ATP
- Y121 (= Y119) binding ATP
- D178 (= D176) binding Mg(2+)
- G185 (= G183) binding pyridoxal 5'-phosphate
- G186 (= G184) binding pyridoxal 5'-phosphate
- G187 (= G185) binding pyridoxal 5'-phosphate
- G188 (= G186) binding pyridoxal 5'-phosphate
- M189 (≠ L187) binding pyridoxal 5'-phosphate
- E210 (= E208) binding Ca(2+); binding Mg(2+); binding Mn(2+)
- A214 (= A212) binding Ca(2+); binding Mg(2+); binding Mn(2+)
- D216 (= D214) binding Ca(2+); binding Mg(2+); binding Mn(2+)
- N247 (≠ R244) binding Ca(2+); binding Mg(2+)
- K279 (= K276) binding ATP
- S313 (= S307) binding pyridoxal 5'-phosphate
- N316 (= N310) binding ATP
6zspAAA serine racemase bound to atp and malonate. (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:310/320 of 6zspAAA
- active site: K53 (= K57), S74 (= S82), E200 (= E208), A204 (= A212), D206 (= D214), G229 (= G236), L302 (≠ I306), S303 (= S307)
- binding adenosine-5'-triphosphate: S28 (≠ C32), S29 (≠ E33), I30 (≠ A34), K48 (= K52), T49 (≠ V53), Q79 (≠ A87), Y111 (= Y119), E266 (= E273), R267 (= R274), K269 (= K276), N306 (= N310)
- binding magnesium ion: E200 (= E208), A204 (= A212), D206 (= D214)
- binding malonate ion: K53 (= K57), S73 (= S81), S74 (= S82), N76 (= N84), H77 (= H85), R125 (= R133), G229 (= G236), S232 (≠ T239)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:317/320 of 7nbhAAA
- active site: K53 (= K57), S81 (= S82), E207 (= E208), A211 (= A212), D213 (= D214), G236 (= G236), L309 (≠ I306), S310 (= S307)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (= D214)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S82), G85 (≠ A86), Q86 (≠ A87), K111 (= K112), I115 (≠ V116), Y118 (= Y119), D235 (= D235), P281 (= P281), N313 (= N310), V314 (= V311), D315 (= D312)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:317/323 of 7nbfAAA
- active site: K53 (= K57), S81 (= S82), E207 (= E208), A211 (= A212), D213 (= D214), G236 (= G236), L309 (≠ I306), S310 (= S307)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (= D214)
- binding magnesium ion: N244 (≠ R244)
- binding pyridoxal-5'-phosphate: F52 (= F56), K53 (= K57), N83 (= N84), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ L237), T282 (≠ S282), S310 (= S307), G311 (= G308)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (= H25), L22 (≠ H26), T23 (= T27), P24 (= P28), L26 (= L30), T27 (= T31), F46 (= F50)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:317/323 of 7nbdAAA
- active site: K53 (= K57), S81 (= S82), E207 (= E208), A211 (= A212), D213 (= D214), G236 (= G236), L309 (≠ I306), S310 (= S307)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (= D214)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F272), L278 (≠ V278), V314 (= V311), L316 (≠ V313)
- binding magnesium ion: N244 (≠ R244)
- binding pyridoxal-5'-phosphate: F52 (= F56), K53 (= K57), N83 (= N84), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ L237), E280 (= E280), T282 (≠ S282), S310 (= S307), G311 (= G308)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:317/323 of 7nbcCCC
- active site: K53 (= K57), S81 (= S82), E207 (= E208), A211 (= A212), D213 (= D214), G236 (= G236), L309 (≠ I306), S310 (= S307)
- binding biphenyl-4-ylacetic acid: T78 (= T79), H79 (= H80), H84 (= H85), V148 (≠ I149), H149 (≠ P150), P150 (= P151)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (= D214)
- binding pyridoxal-5'-phosphate: F52 (= F56), K53 (= K57), N83 (= N84), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ L237), T282 (≠ S282), S310 (= S307), G311 (= G308)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:317/323 of 7nbcAAA
- active site: K53 (= K57), S81 (= S82), E207 (= E208), A211 (= A212), D213 (= D214), G236 (= G236), L309 (≠ I306), S310 (= S307)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (= D214)
- binding magnesium ion: N244 (≠ R244)
- binding pyridoxal-5'-phosphate: F52 (= F56), K53 (= K57), N83 (= N84), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ L237), T282 (≠ S282), S310 (= S307), G311 (= G308)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 8:317/322 of 7nbgAAA
- active site: K53 (= K57), S81 (= S82), E207 (= E208), A211 (= A212), D213 (= D214), G236 (= G236), L309 (≠ I306), S310 (= S307)
- binding calcium ion: E207 (= E208), A211 (= A212), D213 (= D214)
- binding pyridoxal-5'-phosphate: F52 (= F56), K53 (= K57), N83 (= N84), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ L237), T282 (≠ S282), S310 (= S307), G311 (= G308)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S82), G85 (≠ A86), Q86 (≠ A87), I101 (= I102), K111 (= K112), I115 (≠ V116), Y118 (= Y119)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
44% identity, 95% coverage: 13:316/319 of query aligns to 24:332/339 of Q7XSN8
- E219 (= E208) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D214) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
46% identity, 95% coverage: 12:314/319 of query aligns to 9:313/322 of 3l6bA
- active site: K54 (= K57), S77 (= S82), E203 (= E208), A207 (= A212), D209 (= D214), G232 (= G236), T278 (≠ S282), L305 (≠ I306), S306 (= S307)
- binding malonate ion: K54 (= K57), S76 (= S81), S77 (= S82), N79 (= N84), H80 (= H85), R128 (= R133), G232 (= G236)
- binding manganese (ii) ion: E203 (= E208), A207 (= A212), D209 (= D214)
- binding pyridoxal-5'-phosphate: F53 (= F56), K54 (= K57), N79 (= N84), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), M182 (≠ L187), V233 (≠ L237), E276 (= E280), T278 (≠ S282), S306 (= S307), G307 (= G308)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
46% identity, 94% coverage: 12:312/319 of query aligns to 8:310/310 of 7nbgDDD
- active site: K53 (= K57), S76 (= S82), E202 (= E208), A206 (= A212), D208 (= D214), G231 (= G236), L304 (≠ I306), S305 (= S307)
- binding calcium ion: E202 (= E208), A206 (= A212), D208 (= D214)
- binding magnesium ion: N239 (≠ R244)
- binding ortho-xylene: S76 (= S82), Q81 (≠ A87), I96 (= I102), Y113 (= Y119)
- binding pyridoxal-5'-phosphate: F52 (= F56), K53 (= K57), N78 (= N84), G177 (= G183), G178 (= G184), G179 (= G185), G180 (= G186), M181 (≠ L187), G231 (= G236), V232 (≠ L237), E275 (= E280), T277 (≠ S282), S305 (= S307), G306 (= G308)
Sites not aligning to the query:
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
43% identity, 99% coverage: 1:315/319 of query aligns to 1:316/323 of O59791
- K57 (= K57) active site, Proton acceptor; modified: Lysino-D-alanine (Lys); alternate; modified: N6-(pyridoxal phosphate)lysine; alternate
- S82 (= S82) active site, Proton acceptor; mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
- N84 (= N84) binding pyridoxal 5'-phosphate
- G183 (= G183) binding pyridoxal 5'-phosphate
- G184 (= G184) binding pyridoxal 5'-phosphate
- G185 (= G185) binding pyridoxal 5'-phosphate
- G186 (= G186) binding pyridoxal 5'-phosphate
- L187 (= L187) binding pyridoxal 5'-phosphate
- E208 (= E208) binding Mg(2+)
- G212 (≠ A212) binding Mg(2+)
- D214 (= D214) binding Mg(2+)
- S308 (= S307) binding pyridoxal 5'-phosphate
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
44% identity, 97% coverage: 7:315/319 of query aligns to 2:311/318 of 1wtcA
- active site: K52 (= K57), S77 (= S82), E203 (= E208), G207 (≠ A212), D209 (= D214), G231 (= G236), I302 (= I306), S303 (= S307)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ H25), K47 (= K52), M48 (≠ V53), A109 (= A114), A110 (= A115), Y114 (= Y119)
- binding magnesium ion: E203 (= E208), G207 (≠ A212), D209 (= D214)
- binding pyridoxal-5'-phosphate: F51 (= F56), K52 (= K57), N79 (= N84), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), G231 (= G236), E276 (= E280), T278 (≠ S282), S303 (= S307)
1v71A Crystal structure of s.Pombe serine racemase
44% identity, 97% coverage: 7:315/319 of query aligns to 2:311/318 of 1v71A
- active site: K52 (= K57), S77 (= S82), E203 (= E208), G207 (≠ A212), D209 (= D214), G231 (= G236), I302 (= I306), S303 (= S307)
- binding magnesium ion: E203 (= E208), G207 (≠ A212), D209 (= D214)
- binding pyridoxal-5'-phosphate: F51 (= F56), K52 (= K57), N79 (= N84), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), G231 (= G236), E276 (= E280), T278 (≠ S282), S303 (= S307), G304 (= G308)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
44% identity, 97% coverage: 7:315/319 of query aligns to 3:312/319 of 2zr8A
- active site: K53 (= K57), S78 (= S82), E204 (= E208), G208 (≠ A212), D210 (= D214), G232 (= G236), I303 (= I306), S304 (= S307)
- binding magnesium ion: E204 (= E208), G208 (≠ A212), D210 (= D214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F56), K53 (= K57), S77 (= S81), S78 (= S82), N80 (= N84), H81 (= H85), P147 (= P151), G179 (= G183), G180 (= G184), G181 (= G185), G182 (= G186), G232 (= G236), E277 (= E280), T279 (≠ S282), S304 (= S307)
- binding serine: S78 (= S82), R129 (= R133), D231 (= D235), G232 (= G236), A233 (≠ L237), Q234 (≠ L238), T235 (= T239)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
44% identity, 97% coverage: 7:315/319 of query aligns to 3:312/319 of 2zpuA
- active site: K53 (= K57), S78 (= S82), E204 (= E208), G208 (≠ A212), D210 (= D214), G232 (= G236), I303 (= I306), S304 (= S307)
- binding magnesium ion: E204 (= E208), G208 (≠ A212), D210 (= D214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F56), K53 (= K57), S77 (= S81), S78 (= S82), N80 (= N84), H81 (= H85), P147 (= P151), G179 (= G183), G180 (= G184), G181 (= G185), G182 (= G186), G232 (= G236), E277 (= E280), T279 (≠ S282), S304 (= S307)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
42% identity, 95% coverage: 12:315/319 of query aligns to 8:312/319 of A4F2N8
- K53 (= K57) mutation to A: Loss of enzymatic activity.
5cvcA Structure of maize serine racemase (see paper)
43% identity, 95% coverage: 13:316/319 of query aligns to 8:316/329 of 5cvcA
- active site: K52 (= K57), S77 (= S82), E203 (= E208), A207 (= A212), D209 (= D214), G231 (= G236), V306 (≠ I306), S307 (= S307)
- binding magnesium ion: E203 (= E208), A207 (= A212), D209 (= D214)
- binding pyridoxal-5'-phosphate: F51 (= F56), K52 (= K57), N79 (= N84), S178 (≠ G183), G179 (= G184), G180 (= G185), G181 (= G186), L232 (= L237), E275 (= E280), S307 (= S307), G308 (= G308)
Q76EQ0 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Rattus norvegicus (Rat) (see paper)
44% identity, 96% coverage: 12:318/319 of query aligns to 11:324/333 of Q76EQ0
- K56 (= K57) modified: N6-(pyridoxal phosphate)lysine
- N86 (= N84) binding pyridoxal 5'-phosphate
- N154 (≠ Y152) binding pyridoxal 5'-phosphate
- G185 (= G183) binding pyridoxal 5'-phosphate
- G186 (= G184) binding pyridoxal 5'-phosphate
- G187 (= G185) binding pyridoxal 5'-phosphate
- G188 (= G186) binding pyridoxal 5'-phosphate
- M189 (≠ L187) binding pyridoxal 5'-phosphate
- E210 (= E208) binding Mn(2+)
- A214 (= A212) binding Mn(2+)
- D216 (= D214) binding Mn(2+)
- S313 (= S307) binding pyridoxal 5'-phosphate
3hmkA Crystal structure of serine racemase (see paper)
45% identity, 96% coverage: 12:316/319 of query aligns to 9:320/321 of 3hmkA
- active site: K54 (= K57), S82 (= S82), E208 (= E208), A212 (= A212), D214 (= D214), G237 (= G236), T283 (≠ S282), L310 (≠ I306), S311 (= S307)
- binding manganese (ii) ion: E208 (= E208), A212 (= A212), D214 (= D214)
- binding pyridoxal-5'-phosphate: F53 (= F56), K54 (= K57), N84 (= N84), G183 (= G183), G184 (= G184), G185 (= G185), G186 (= G186), M187 (≠ L187), G237 (= G236), V238 (≠ L237), T283 (≠ S282), S311 (= S307), G312 (= G308)
Query Sequence
>Echvi_1189 FitnessBrowser__Cola:Echvi_1189
MQQTYRIPQLIDIKQAYQRIMAYIHHTPILTCEAINKMADCQLYFKCENFQKVGAFKARG
ATNAILKLPPGLKKNGVATHSSGNHAAALARAAKETGTKAYIVMPSTAAAIKKAAVRTYG
GEIIECEPNLKARETTLEKVVEETGAAFIPPYDYMDVIEGQATCALEMWDEGIPFDAIIT
PVGGGGLLAGTALTTHYLSRKTPVYGAEPKGADDAYRSLKANKIIPMENPNTIADGLLTS
LGKRNFTIISKNVADILTVSDDQIIAAMRLVFERMKLVIEPSSAVPLAAILANKPLFQNK
RVGIVISGGNVDVSKLPFT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory