SitesBLAST
Comparing Echvi_1267 FitnessBrowser__Cola:Echvi_1267 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
23% identity, 94% coverage: 17:550/567 of query aligns to 19:482/502 of P07117
- R257 (= R266) mutation to C: Sodium-independent binding affinity for proline.
- C281 (≠ L290) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (≠ G391) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (≠ I396) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (= R422) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
24% identity, 33% coverage: 6:191/567 of query aligns to 15:204/643 of Q92911
- A102 (= A88) natural variant: A -> P
Sites not aligning to the query:
- 226 mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- 237 D→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- 242 Required for homodimerization; Y→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- 243 Required for homodimerization; T→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
3dh4A Crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus (see paper)
29% identity, 24% coverage: 362:496/567 of query aligns to 303:437/512 of 3dh4A
Sites not aligning to the query:
Q9NY91 Probable glucose sensor protein SLC5A4; Solute carrier family 5 member 4 from Homo sapiens (Human) (see paper)
27% identity, 23% coverage: 369:498/567 of query aligns to 374:508/659 of Q9NY91
- E457 (= E445) mutation to Q: Confers sugar transport activity not found in the wild-type protein. Increased sensitivity to inhibitor phlorizin.
8hinA Structure of human sglt2-map17 complex with phlorizin (see paper)
26% identity, 30% coverage: 15:186/567 of query aligns to 20:185/588 of 8hinA
- binding 1-[2-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-4,6-bis(oxidanyl)phenyl]-3-(4-hydroxyphenyl)propan-1-one: S46 (≠ G39), A49 (vs. gap), S50 (= S41), G53 (≠ A44), D177 (≠ Q178), T181 (≠ Y182)
Sites not aligning to the query:
- binding 1-[2-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-4,6-bis(oxidanyl)phenyl]-3-(4-hydroxyphenyl)propan-1-one: 276, 369
- binding : 574, 578, 581, 582, 585, 586
P31639 Sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2 from Homo sapiens (Human) (see paper)
25% identity, 30% coverage: 15:186/567 of query aligns to 33:209/672 of P31639
- V95 (= V75) mutation to A: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- F98 (≠ M78) mutation to A: Slightly decreases D-glucose transporter activity. Abolishes the binding to inhibitor, empagliflozin.
- V157 (≠ G134) mutation to A: Decreases D-glucose transporter activity.
Sites not aligning to the query:
- 283 L→M: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- 453 F→A: Slightly decreases D-glucose transporter activity. Greatly reduces the binding to inhibitor, empagliflozin.
Query Sequence
>Echvi_1267 FitnessBrowser__Cola:Echvi_1267
MDILTWTYILVGLSFALYIGIAIWSRAGSTKEFYVAGGGVSPLANGMATGADWMSAASFI
SMAGLISFMGYDGSVYLMGWTGGYVLLALLLAPYLRKFGKFTVPDFVGDRYYSNKARVVA
VFCAIFISFTYVAGQMRGVGIVFSRYLEVDINTGVIIGMCIVFFYAVLGGMKGITYTQVA
QYCVLIFAFMVPAIFISMQLTSNPIPQLGLGGTVADGTYLLDKLDGVLTDLGFHAYTSGK
KSMGDMFAITLALMVGTAGLPHVIVRFFTVPRVKDARLSAGYALVFIAILYTTAPAVSAF
GIYNAIDSVSEKPIDDLPEWVTNWQQTQLIKINDKNQDGVVQYVADPERNEFTIDKDIMV
LANPEIAQLPNWVVGLVAAGGMAAALSTAAGLLLVISTSVSRDLAKNFNPGISDKKELLI
ARVAAAVAVIVAGYFGVNPPGFVAEVVAFAFGLAAASFFPVIIMGIFSKRMNKEGAIWGM
LVGLVFTLSYIIYFKFGTDLFGIPAESLTAEHWWFGISPEGIGSIGMVLNFLVSFVVSRV
TPAPPEAVQEMVEDIRIPRGAGQAQGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory