Comparing Echvi_1282 FitnessBrowser__Cola:Echvi_1282 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
46% identity, 99% coverage: 1:499/502 of query aligns to 4:494/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 44% coverage: 1:223/502 of query aligns to 2:221/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 44% coverage: 1:223/502 of query aligns to 1:221/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 44% coverage: 1:223/502 of query aligns to 4:235/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 44% coverage: 1:223/502 of query aligns to 4:235/253 of 1g9xB
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 45% coverage: 1:225/502 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 45% coverage: 1:225/502 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 45% coverage: 1:225/502 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 45% coverage: 1:225/502 of query aligns to 3:225/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
28% identity, 48% coverage: 1:241/502 of query aligns to 4:244/280 of 5x40A
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 41% coverage: 14:218/502 of query aligns to 20:222/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 41% coverage: 14:218/502 of query aligns to 20:222/615 of 5lilA
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 44% coverage: 1:219/502 of query aligns to 4:224/648 of P75831
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 46% coverage: 2:230/502 of query aligns to 4:233/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 46% coverage: 2:230/502 of query aligns to 4:233/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 46% coverage: 2:230/502 of query aligns to 4:233/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 46% coverage: 2:230/502 of query aligns to 4:233/353 of Q97UY8
3d31A Modbc from methanosarcina acetivorans (see paper)
28% identity, 50% coverage: 1:249/502 of query aligns to 1:243/348 of 3d31A
Sites not aligning to the query:
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
28% identity, 42% coverage: 6:216/502 of query aligns to 3814:4020/5034 of Q5SSE9
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 44% coverage: 2:223/502 of query aligns to 7:238/258 of P02915
>Echvi_1282 FitnessBrowser__Cola:Echvi_1282
MLTVKNITKEFVGVKALDDVSLELQAGRVTAILGENGAGKSTLMKILSGVYPDYKGTIYY
NGDPVKFQNTRDAQEKGINIIHQELNLIPYLSIRENIFLGREPETPMGLLDVAKMHKEAA
QLLHRLKLNVDPETPVSQLKVGQQQLVEIAKALSLESQVIIMDEPTSAISDQEVEILFGI
IRALRAEGKAIAYISHKLDELFAIADRYVVLRDGKMIESGEMEGMTEEALIQKMVGREIV
IERSCSGRQFDETVLSVKHLTVKHPKIADKFLLQDINFELGKGEVLGIFGLMGAGRTELM
EALFGVLPHQGAEITLAGKVHEFQKPQEAMDAGLALVPEDRKQDGLVLCMDLCTNSSLTV
VDSILSGGLLDDKKEKGLAQKYMGELKIKASSHRQLVEKLSGGNQQKVVLAKWLATRPKV
LMLDEPTRGIDINAKNEIYKLIRQLANEGLGLIVVSSELPEILAVSDRVLVMAEGRLTAN
IPIDAQTSEDEILQAAIPKKKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory