SitesBLAST
Comparing Echvi_1296 FitnessBrowser__Cola:Echvi_1296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
52% identity, 99% coverage: 3:509/513 of query aligns to 1:502/502 of 6brlA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of 2cv2A
- active site: K246 (= K266)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R8), A7 (= A10), S9 (= S12), G17 (= G20), I21 (≠ T24), E41 (= E44), Y187 (= Y204), R205 (= R222), A206 (≠ G223), E208 (= E225), W209 (= W226), L235 (= L254), L236 (= L255)
- binding : S9 (= S12), T43 (= T46), D44 (= D47), R47 (= R50), V145 (= V162), R163 (= R180), Y168 (≠ V185), E172 (≠ T189), V177 (= V194), K180 (= K197), S181 (= S198), Y187 (= Y204), E207 (= E224), E208 (= E225), W209 (= W226), V211 (≠ P228), R237 (≠ L256), K241 (≠ G260), L272 (≠ F309), M273 (≠ L310), G274 (= G311), E282 (= E319), S299 (≠ G336), P303 (≠ T340), V304 (≠ K341), K309 (= K346), W312 (= W349), R319 (≠ K356), P357 (≠ E392), R358 (= R393), R417 (≠ E455), Q432 (= Q470), R435 (= R473), L442 (≠ G480), E443 (≠ A481), T444 (≠ G482), G446 (≠ D484), L447 (= L485), F448 (≠ M486)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of 2cv1A
- active site: K246 (= K266)
- binding adenosine-5'-triphosphate: P8 (= P11), S9 (= S12), G17 (= G20), T18 (≠ G21), I21 (≠ T24), R47 (= R50), A206 (≠ G223), W209 (= W226), L235 (= L254), L236 (= L255)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R8), A7 (= A10), E41 (= E44), Y187 (= Y204), R205 (= R222), W209 (= W226)
- binding : S9 (= S12), E41 (= E44), T43 (= T46), D44 (= D47), R47 (= R50), V145 (= V162), R163 (= R180), V166 (= V183), E172 (≠ T189), V177 (= V194), K180 (= K197), S181 (= S198), Y187 (= Y204), E207 (= E224), E208 (= E225), W209 (= W226), V211 (≠ P228), R237 (≠ L256), K241 (≠ G260), K243 (= K263), M273 (≠ L310), G274 (= G311), S276 (≠ N313), E282 (= E319), S299 (≠ G336), P303 (≠ T340), V304 (≠ K341), K309 (= K346), W312 (= W349), R319 (≠ K356), P357 (≠ E392), R358 (= R393), R417 (≠ E455), L427 (= L465), Q432 (= Q470), R435 (= R473), L442 (≠ G480), E443 (≠ A481), T444 (≠ G482), G446 (≠ D484), L447 (= L485), F448 (≠ M486)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of 1n78A
- active site: K246 (= K266)
- binding glutamol-amp: R5 (= R8), A7 (= A10), P8 (= P11), S9 (= S12), G17 (= G20), T18 (≠ G21), I21 (≠ T24), E41 (= E44), Y187 (= Y204), N191 (= N208), R205 (= R222), A206 (≠ G223), E208 (= E225), W209 (= W226), L235 (= L254), L236 (= L255)
- binding : S9 (= S12), T43 (= T46), D44 (= D47), R47 (= R50), V145 (= V162), R163 (= R180), V166 (= V183), Y168 (≠ V185), E172 (≠ T189), V177 (= V194), K180 (= K197), S181 (= S198), Y187 (= Y204), E207 (= E224), E208 (= E225), W209 (= W226), L210 (= L227), V211 (≠ P228), R237 (≠ L256), K241 (≠ G260), M273 (≠ L310), G274 (= G311), E282 (= E319), R297 (= R334), P303 (≠ T340), V304 (≠ K341), K309 (= K346), W312 (= W349), R319 (≠ K356), P357 (≠ E392), R358 (= R393), R417 (≠ E455), L427 (= L465), Q432 (= Q470), R435 (= R473), L442 (≠ G480), E443 (≠ A481), T444 (≠ G482), G446 (≠ D484), L447 (= L485), F448 (≠ M486)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of 1j09A
- active site: K246 (= K266)
- binding adenosine-5'-triphosphate: H15 (= H18), E208 (= E225), L235 (= L254), L236 (= L255), K243 (= K263), I244 (≠ L264), S245 (= S265), K246 (= K266), R247 (= R267)
- binding glutamic acid: R5 (= R8), A7 (= A10), S9 (= S12), E41 (= E44), Y187 (= Y204), N191 (= N208), R205 (= R222), W209 (= W226)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of P27000
- R358 (= R393) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
40% identity, 98% coverage: 5:505/513 of query aligns to 2:467/468 of 1g59A
- binding : D44 (= D47), R45 (≠ Q48), A46 (≠ T49), R47 (= R50), P109 (≠ S112), V145 (= V162), R163 (= R180), V166 (= V183), E172 (≠ T189), V177 (= V194), K180 (= K197), S181 (= S198), D182 (= D199), E207 (= E224), E208 (= E225), R237 (≠ L256), K241 (≠ G260), T242 (≠ N261), K243 (= K263), M273 (≠ L310), G274 (= G311), E282 (= E319), S299 (≠ G336), L300 (≠ K337), P303 (≠ T340), V304 (≠ K341), K309 (= K346), W312 (= W349), R319 (≠ K356), P357 (≠ E392), R358 (= R393), R417 (≠ E455), K426 (= K464), L427 (= L465), Q432 (= Q470), R435 (= R473), L442 (≠ G480), E443 (≠ A481), T444 (≠ G482), P445 (= P483), G446 (≠ D484), L447 (= L485), F448 (≠ M486)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
36% identity, 99% coverage: 5:510/513 of query aligns to 2:484/485 of 4griB
- active site: S9 (= S12), K253 (= K266)
- binding glutamic acid: R5 (= R8), A7 (= A10), S9 (= S12), E41 (= E44), Y194 (= Y204), R212 (= R222), W216 (= W226)
- binding zinc ion: C105 (≠ A108), C107 (≠ D110), Y128 (= Y132), C132 (≠ T136)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
38% identity, 98% coverage: 5:508/513 of query aligns to 4:469/488 of 8vc5A
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 98% coverage: 4:506/513 of query aligns to 2:462/471 of P04805
- C98 (≠ A108) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ D110) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ T136) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ T138) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ M140) mutation to Q: No change in activity or in zinc content.
- H131 (≠ N142) mutation to Q: No change in activity or in zinc content.
- H132 (≠ S143) mutation to Q: No change in activity or in zinc content.
- C138 (≠ Y161) mutation to S: No change in activity or in zinc content.
- S239 (= S265) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
33% identity, 98% coverage: 4:506/513 of query aligns to 2:462/468 of 8i9iA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
35% identity, 98% coverage: 5:508/513 of query aligns to 103:562/564 of 3al0C
- active site: S110 (= S12), K335 (= K266)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R8), A108 (= A10), P109 (= P11), G118 (= G20), T122 (= T24), E142 (= E44), Y276 (= Y204), R294 (= R222), G295 (= G223), D297 (≠ E225), H298 (≠ W226), L324 (= L254), I325 (≠ L255), L333 (= L264)
- binding : T144 (= T46), D145 (= D47), R148 (= R50), Y208 (≠ D110), P213 (≠ A117), K252 (≠ R180), M255 (≠ V183), I266 (≠ V194), K269 (= K197), S270 (= S198), Y276 (= Y204), D297 (≠ E225), H298 (≠ W226), L299 (= L227), S300 (≠ P228), N301 (≠ S229), K304 (≠ I232), R330 (≠ N261), P332 (≠ K263), G363 (= G311), W364 (= W312), R365 (≠ N313), E370 (= E319), S387 (≠ G336), K389 (≠ S338), V391 (≠ T340), I392 (≠ K341), K397 (= K346), W400 (= W349), R407 (≠ K356), E446 (= E392), K447 (≠ R393), Q453 (≠ D399), I457 (≠ E403), R509 (≠ K451), K520 (≠ E462), Q524 (= Q470), R527 (= R473), V535 (≠ A481), T536 (≠ G482), G538 (≠ D484), L539 (= L485)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
34% identity, 95% coverage: 5:492/513 of query aligns to 3:464/485 of Q8DLI5
- R6 (= R8) binding
- Y192 (= Y204) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
34% identity, 95% coverage: 5:492/513 of query aligns to 2:463/484 of 2cfoA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
33% identity, 80% coverage: 3:413/513 of query aligns to 1:358/380 of 4g6zA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
29% identity, 63% coverage: 8:329/513 of query aligns to 19:283/308 of P27305
- E55 (= E44) binding
- Y182 (= Y204) binding
- R200 (= R222) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
29% identity, 63% coverage: 8:329/513 of query aligns to 7:269/290 of 4a91A
- active site: S11 (= S12), K229 (= K266)
- binding glutamic acid: R7 (= R8), A9 (= A10), S11 (= S12), E43 (= E44), Y170 (= Y204), R188 (= R222), L192 (≠ W226)
- binding zinc ion: C99 (≠ A108), C101 (≠ I135), Y113 (≠ P147), C117 (≠ V151)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 61% coverage: 4:317/513 of query aligns to 10:284/455 of 3aiiA
O13775 Probable glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 45% coverage: 1:233/513 of query aligns to 203:415/716 of O13775
Sites not aligning to the query:
- 190 modified: Phosphoserine
Query Sequence
>Echvi_1296 FitnessBrowser__Cola:Echvi_1296
MNKEVRVRFAPSPTGALHIGGVRTALYNYLFAKKNQGKFLLRIEDTDQTRFVKGAEEYIK
EALEWIGITPDESPWKEGPHGPYRQSERKPLYMQYAMDLVEKGHAYYAFDTSEELDAMRE
RLTAARVVSPQYNSITRTQMKNSLTLPEDEVKARLESGDPYVIRLKVPRKEEIRLNDMIR
GWVMVHSNTLDDKVLMKSDGMPTYHLANIVDDHLMGITHVIRGEEWLPSAPIHVLLYRYL
GWEDTMPQFAHLPLLLKPDGNGKLSKRDADKNGFPIFPMDWTDPRTGDFSQGFRQAGYFP
DAFVNFLAFLGWNPGDNQEIFSMEELINAFSVERIGKSGTKFDINKAKWFNEQYLKAKSN
HDLAQYLIEDLKQEGIEILQAKAEQIVAIMKERATFPSDLWKEGRFMLIAPTEFDEKVAA
KKWNEDVVAVLTAYRDALDKFEGEFTPQSAKAMLESAAESQEIKLGKVMQAVRLAVTGVG
AGPDLMEIFTIIGKDELIKRIDFALNTLEVKAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory