SitesBLAST
Comparing Echvi_1439 FitnessBrowser__Cola:Echvi_1439 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
24% identity, 97% coverage: 14:562/566 of query aligns to 4:537/537 of 7w2jD
- binding fe3-s4 cluster: R200 (≠ H215), C211 (= C226), G213 (≠ Y228), N214 (≠ R229), N215 (= N230), C217 (= C232), C221 (= C236), I223 (≠ F238), A225 (≠ G240), S338 (≠ G363)
- binding flavin-adenine dinucleotide: G9 (= G19), G11 (= G21), D32 (≠ E42), A33 (vs. gap), Y59 (≠ H77), K97 (≠ R112), G101 (= G118), T102 (≠ R119), T103 (≠ S120), H105 (≠ M122), W106 (= W123), S109 (≠ Q126), V249 (≠ L270), A284 (= A303), N285 (≠ S304), E288 (≠ G307), K291 (≠ W310), L292 (≠ I311), N472 (≠ G494), N516 (= N541), S517 (≠ P542), T518 (≠ S543)
- binding heme c: P209 (≠ G224), I223 (≠ F238)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
24% identity, 97% coverage: 14:562/566 of query aligns to 7:540/540 of 8jejA
- binding fe3-s4 cluster: R203 (≠ H215), C214 (= C226), C215 (≠ Q227), G216 (≠ Y228), N217 (≠ R229), N218 (= N230), N219 (≠ L231), C220 (= C232), C224 (= C236), I226 (≠ F238), M229 (≠ Y241), S341 (≠ G363)
- binding flavin-adenine dinucleotide: I11 (≠ V18), G12 (= G19), G14 (= G21), I15 (= I22), C16 (≠ S23), D35 (≠ E42), A36 (vs. gap), G97 (≠ N109), K100 (≠ R112), G101 (= G113), G104 (= G118), T105 (≠ R119), T106 (≠ S120), H108 (≠ M122), W109 (= W123), A110 (≠ G124), S112 (≠ Q126), M221 (≠ A233), A250 (≠ E268), V252 (≠ L270), A287 (= A303), N288 (≠ S304), E291 (≠ G307), N475 (≠ G494), H476 (= H495), N519 (= N541), T521 (≠ S543), M524 (≠ Y546)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
25% identity, 79% coverage: 116:561/566 of query aligns to 91:531/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C226), C205 (≠ Q227), G206 (≠ Y228), N207 (≠ R229), N209 (≠ L231), C210 (= C232), C214 (= C236), P331 (= P361)
- binding flavin-adenine dinucleotide: T94 (≠ R119), H97 (≠ M122), W98 (= W123), A99 (≠ G124), S101 (≠ Q126), M211 (≠ A233), V242 (≠ L270), A277 (= A303), N278 (≠ S304), E281 (≠ G307), I285 (= I311), N467 (≠ G494), N511 (= N541), T513 (≠ S543)
- binding D-glucono-1,5-lactone: M211 (≠ A233), E333 (= E374), H355 (≠ G396), N466 (≠ P493), N467 (≠ G494), H468 (= H495), N511 (= N541)
Sites not aligning to the query:
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
24% identity, 54% coverage: 264:566/566 of query aligns to 225:492/494 of 7qf8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 114, 119, 120, 124, 125, 127
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
23% identity, 54% coverage: 264:566/566 of query aligns to 209:458/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114
- binding alpha-D-glucopyranose: 77, 112
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
22% identity, 54% coverage: 264:566/566 of query aligns to 205:457/457 of 7qvaA
- binding flavin-adenine dinucleotide: L206 (≠ I265), V207 (= V266), G241 (≠ N302), A242 (= A303), D243 (≠ S304), R246 (≠ G307), L387 (≠ I497), H388 (= H498), N432 (= N541), T434 (≠ S543)
- binding Mangiferin: M299 (≠ G392), A385 (≠ H495), S386 (≠ C496), H388 (= H498)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110
- binding Mangiferin: 51, 73, 108
7dveA Crystal structure of fad-dependent c-glycoside oxidase (see paper)
23% identity, 54% coverage: 257:561/566 of query aligns to 213:493/498 of 7dveA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 103, 108, 109, 112, 113, 114, 116
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
23% identity, 24% coverage: 425:561/566 of query aligns to 433:569/570 of 4migA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 128, 129, 130, 133, 134, 137, 138, 139, 141, 262, 302, 306
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 139, 407, 411, 415
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
23% identity, 24% coverage: 425:561/566 of query aligns to 444:580/581 of 4mifB
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 138, 142, 143, 146, 147, 148, 149, 150, 271, 312, 313, 316
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
23% identity, 24% coverage: 425:561/566 of query aligns to 439:575/576 of 4mihA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 22, 23, 24, 43, 44, 136, 137, 138, 141, 142, 146, 147, 149, 270, 310, 314
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 413, 417, 421
Q6UG02 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Phlebiopsis gigantea (White-rot fungus) (Peniophora gigantea) (see paper)
26% identity, 26% coverage: 417:562/566 of query aligns to 471:612/622 of Q6UG02
- E540 (≠ P492) mutation to K: In P2OxB1; increases thermostability up to 70 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 3.1-fold for D-xylose and 7.3-fold for L-sorbose, mainly by lowering the Km values for these two substrates to 6.6 mM and 5.4 mM, respectively. In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-312.
Sites not aligning to the query:
- 167 H→C: Decreases activity by 90%.
- 312 K→E: In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-540.
4mofA Pyranose 2-oxidase h450g mutant with 2-fluorinated glucose (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 425:563/573 of 4mofA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 114, 118, 119, 122, 123, 124, 126, 238, 275, 279, 409
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: 124, 403, 407, 411
4molA Pyranose 2-oxidase h167a mutant with 2-fluorinated galactose (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 425:563/573 of 4molA
Sites not aligning to the query:
- binding 2-deoxy-2-fluoro-beta-D-galactopyranose: 403, 407, 409, 411
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
3pl8A Pyranose 2-oxidase h167a complex with 3-deoxy-3-fluoro-beta-d-glucose (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 425:563/573 of 3pl8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 124, 403, 407, 411
3lsmA Pyranose 2-oxidase h167a mutant with flavin n(5) sulfite adduct (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 426:564/574 of 3lsmA
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: R428 (≠ S419), H504 (= H498), N549 (= N541), T551 (≠ S543)
- binding sulfite ion: R527 (≠ Q519), G530 (≠ E522), K532 (≠ P524)
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 19, 20, 157, 161, 566
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: 11, 12, 13, 32, 33, 114, 119, 120, 124, 125, 126, 127, 239, 276, 280
- binding sulfite ion: 249
4mooA Pyranose 2-oxidase h450g mutant with 2-fluorinated galactose (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 428:566/576 of 4mooA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 128, 129, 241, 278, 282
- binding 2-deoxy-2-fluoro-alpha-D-galactopyranose: 127, 406, 410, 412, 414
4momA Pyranose 2-oxidase h450g mutant with 3-fluorinated galactose (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 428:566/576 of 4momA
Sites not aligning to the query:
- binding 3-deoxy-3-fluoro-beta-D-galactopyranose: 127, 406, 410, 414
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278
4moeA Pyranose 2-oxidase h450g mutant with 3-fluorinated glucose (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 428:566/576 of 4moeA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 117, 121, 122, 125, 126, 127, 128, 129, 241, 278
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 127, 406, 410, 412, 414
3bg6A Pyranose 2-oxidase from trametes multicolor, e542k mutant (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 428:566/577 of 3bg6A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
2f5vA Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus peniophora sp. (see paper)
24% identity, 25% coverage: 417:556/566 of query aligns to 428:566/577 of 2f5vA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278, 282
- binding beta-D-arabino-hexopyranos-2-ulose: 127, 406, 410
Query Sequence
>Echvi_1439 FitnessBrowser__Cola:Echvi_1439
MNLNIKATKENTYDAIVVGSGISGGWAAKELCEKGLKTLVLERGKNVEHIKGYPTTNLNP
WELDHRGWSTNESKEKHPIQSRCYAFGEDTQQFWVNDLENPYNEVKPFNWLRGYHVGGRS
LMWGRQCYRLSDIDFEANAKDGYGVDWPVRYKDLAPWYTYVEKFAGISGQAEGLPQLPDS
HFLPAMEMNCVEKHVAARVKEKFDDRIITIGRAAHATAALNGRGPCQYRNLCARGCPFGG
YFSSNSATLPAAMQTGNMTLRPFSIVTEVLYDKETGKANGVRIMDAETKEYTEYYAKVVF
LNASTLGTAWILLNSVSDAFPNGLGNGSEQVGHNLMDHHYGVGASGAIEGFGDKYYYGRR
PNGIYVPRFRNISEATERPDYVRGFGYQGGAGRGRGQGGPAGVGADFKLSKTQPSEDWSF
GIGSWGEHLPYYDNKVSLNHDKLDAYGLPTLDIDCEFKENEMAMRKDMRQSAVDILEAVG
AKNINSYDSAPPPGHCIHEMGTARMGKDPKTSVLNGYNQMHEVPNVYITDGAFMASSACQ
NPSLTYMAFTARACDHAVKELKKQNL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory